The activity of the TRPM7 channel is negatively regulated by intracellular Mg2+. We previously reported that oxidative stress enhances the inhibition of TRPM7 by intracellular Mg2+. Here, we aimed to clarify the mechanism underlying TRPM7 inhibition by hydrogen peroxide (H2O2). Site-directed mutagenesis of full-length TRPM7 revealed that none of the cysteines other than C1809 and C1813 within the zinc-binding motif of the TRPM7 kinase domain were involved in the H2O2-induced TRPM7 inhibition. Mutation of C1809 or C1813 prevented expression of full-length TRPM7 on the plasma membrane. We therefore developed an assay to functionally reconstitute full-length TRPM7 by coexpressing the TRPM7 channel domain (M7cd) and the TRPM7 kinase domain (M7kd) as separate proteins in HEK293 cells. When M7cd was expressed alone, the current was inhibited by intracellular Mg2+ more strongly than that of full-length TRPM7 and was insensitive to oxidative stress. Coexpression of M7cd and M7kd attenuated the inhibition by intracellular Mg2+ and restored sensitivity to oxidative stress, indicating successful reconstitution of a full-length TRPM7-like current. We observed a similar effect when M7cd was coexpressed with the kinase-inactive mutant M7kd-K1645R, suggesting that the kinase activity is not essential for the reconstitution. However, coexpression of M7cd and M7kd carrying a mutation at either C1809 or C1813 failed to restore the full-length TRPM7-like current. No reconstitution was observed when using M7kd carrying a mutation at H1750 and H1807, which are involved in the zinc-binding motif formation with C1809 and C1813. These data suggest that the zinc-binding motif is essential for the intracellular Mg2+-dependent regulation of the TRPM7 channel activity by its kinase domain and that the cysteines in the zinc-binding motif play a role in the oxidative stress response of TRPM7.
Introduction
Magnesium ions are important for numerous cellular functions, including cell cycles, channel regulation, enzyme activity, and energy metabolism (reviewed in Wolf and Trapani, 2008; Romani, 2011; de Baaij et al., 2015). TRPM7 is a Mg2+-permeable nonselective cation channel that contains a serine/threonine protein kinase at its C terminus (Bates-Withers et al., 2011; Fleig and Chubanov, 2014). Because the TRPM7 channel is activated upon the reduction of intracellular free Mg2+ concentration ([Mg2+]i) and thereby allows a Mg2+ influx, TRPM7 is considered to play a role in cellular Mg2+ homeostasis (Paravicini et al., 2012; Chubanov et al., 2018). It has been reported that TRPM7-deficient cells exhibit an impairment of proliferation and a decreased survival rate and that these defects are reversed by culturing the cells in a medium containing high Mg2+ (Nadler et al., 2001; Schmitz et al., 2003; Schmitz et al., 2005; Chubanov et al., 2016). Global knockout of TRPM7 in mice results in early embryonic death (Jin et al., 2008; Liu et al., 2011; Jin et al., 2012). This lethality might result from the loss of TRPM7 channel activity but not loss of its kinase activity, because kinase-inactive TRPM7 knock-in mice (TRPM7K1646R/K1646R), in which TRPM7 current is comparable to that in WT mice, develop and live normally with no signs of Mg2+ deficiency throughout their life span (Kaitsuka et al., 2014). Thus, the TRPM7 channel activity, rather than its kinase activity, is pivotal for Mg2+ homeostasis under basal conditions.
It is well established that TRPM7 channel activity is regulated by both extracellular and intracellular Mg2+. Extracellular Mg2+ decreases the current by producing permeation block (Nadler et al., 2001; Monteilh-Zoller et al., 2003), and intracellular Mg2+ inhibits the current in a voltage-independent manner (Nadler et al., 2001; Chokshi et al., 2012a, 2012b). Intracellular Mg2+ decreases both the open probability and the unitary conductance of TRPM7 (Chokshi et al., 2012b; Mittermeier et al., 2019). It has been proposed that TRPM7 has two intracellular Mg2+ sites, with at least one site in the channel domain (Demeuse et al., 2006; Chokshi et al., 2012a), but the precise structural mechanisms underlying the inhibition by intracellular Mg2+ remain to be elucidated.
Although the kinase activity of TRPM7 is not essential for channel activity (Schmitz et al., 2003; Matsushita et al., 2005; Demeuse et al., 2006; Inoue et al., 2014; Kaitsuka et al., 2014), the kinase domain might regulate the channel (Schmitz et al., 2003; Desai et al., 2012; Yu et al., 2013). Whole deletion of the kinase domain (TRPM7-Δkinase) increases the [Mg2+]i sensitivity of the TRPM7 channel (Schmitz et al., 2003; Demeuse et al., 2006; Ryazanova et al., 2010), whereas the kinase-inactive point mutant (K1645R) does not overtly affect its [Mg2+]i sensitivity (Matsushita et al., 2005). Consistently, a reduction in the TRPM7 current and a defect in Mg2+ homeostasis are observed in TRPM7+/Δkinase but not in TRPM7K1646R/K1646R mice (Ryazanova et al., 2010; Kaitsuka et al., 2014; Romagnani et al., 2017). Thus, it is plausible that the structural interactions between the channel domain and the kinase domain are important for the [Mg2+]i-mediated regulation of TRPM7 channel activity.
We have previously reported that oxidative stress induced by hydrogen peroxide (H2O2) inhibited TRPM7 channel activity by enhancing [Mg2+]i-dependent inhibition (Inoue et al., 2014). Our previous study demonstrated that the cysteine modulator N-methylmaleimide (NMM) inhibited the TRPM7 current in a similar Mg2+-dependent fashion to H2O2, suggesting that cysteines act as an oxidative sensor. However, precise molecular mechanisms underlying the oxidative stress–induced TRPM7 inhibition remain to be clarified. In this study, we examined the oxidative stress sensors that are targeted by H2O2 in TRPM7. Our data suggest that the zinc-binding motif of the TRPM7 kinase domain is responsible for the interaction between the channel domain and the kinase domain to regulate [Mg2+]i sensitivity. The oxidation of cysteines in the zinc-binding motif under oxidative stress might interfere with the interaction to inhibit the TRPM7 current.
Materials and methods
Vector constructions
N-terminal streptavidin-binding peptide (SBP)-tagged full-length WT mouse TRPM7 (SBP-mTRPM7-wt) expression vectors were prepared by inserting nucleotides encoding an SBP tag (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) after the first methionine into an mTRPM7-wt pcDNA5/FRT/TO vector generated previously (Inoue et al., 2014). A full-length cDNA of human TRPM7 (hTRPM7; pF1KE3491) was purchased from Kazusa Genome Technologies. The hTRPM7 was cloned into a doxycycline-inducible expression vector pcDNA/FRT/TO (Invitrogen), and the nucleotides encoding the SBP tag were inserted after the first methionine. The mTRPM7 channel domain (M7cd; amino acids [aa] 1–1509) was prepared by inserting a stop codon and XhoI site after 1509 by PCR using a BstXI-SalI fragment as the PCR template. The M7kd (aa 1511–1863) was amplified by PCR using an mTRPM7-wt pcDNA5/FRT/TO vector as the template with the primers 5′-CCACGCGTGCCACCATGTCTAAAGCAGCTTTGTTACC-3′ (MluI site in italics), which includes the ATG start codon (underlined), and 5′-CCCTCGAGCTATAACATCAGACGAACAG-3′ (XhoI site in italics). The PCR product was cloned into a pIRES2-EGFP expression vector (BD Biosciences Clontech) in which the MluI site was inserted at the multicloning site using the MluI and XhoI sites. The full-length coding sequence of mouse TRPM6 (AY333282) was amplified by PCR using cDNA of mouse kidney at the template with the primers 5′-CCGTCGACATGCAGGTCAAGAAATCCTG-3′ (SalI site in italics) and 5′-CCGGATCCTTAAAGGCGTGTGTGATCTT-3′ (M6 reverse primer; BamHI site in italics) and cloned into pBluescript SK(−) (Stratagene) using the SalI and BamHI sites. The TRPM6 kinase domain (M6kd; aa 1651–2028) was amplified by PCR using the mTRPM6-wt pBluescript SK(−) vector as the template with the forward primer 5′-CCACGCGTGCCACCATGAAAATGAAGGAAATCAAG-3′ (MluI site in italics), which includes the ATG start codon (underlined) and the M6 reverse primer, and it was cloned into the pIRES2-EGFP expression vector using the MluI and BamHI sites. Amino acid substitution mutants were generated by site-directed mutagenesis using a QuikChange site-directed mutagenesis kit (Agilent Technologies). The predicted DNA sequences of all constructs were verified by sequencing.
Baculovirus production
Baculovirus carrying vesicular stomatitis virus G protein on the virus envelope that effectively infects mammalian cells was produced as described previously (Uehara et al., 2017). cDNAs for wild-type and mutant M7kd were cloned into the modified pFastBac1 vector (Invitrogen) using the MluI and XhoI sites. Baculovirus was produced in Sf9 cells according to the manufacturer’s instructions. A P2 virus was used for the experiments.
Cells
Stable and doxycycline-inducible HEK293 cell lines overexpressing the WT, mutant, or channel domain of mTRPM7 were generated as previously described (Inoue et al., 2014) using the Flp-In T-REx system (Invitrogen). Cells were maintained in a growth medium consisting of DMEM supplemented with 10% FBS, 2 mM GlutaMAX (Invitrogen), 100 µM hygromycin, 15 µM blasticidin, and penicillin-streptomycin (Invitrogen). To induce protein expression, doxycycline (1 µg/ml) was added to the culture medium the day before the experiments. Experiments were performed 16–30 h after induction.
Transient expression of M7kd
HEK293 cells that were stably transfected with SBP-tagged or nontagged mM7cd were plated into a ⌀35-mm dish (106 cell/dish) and cultured in the growth medium for 24 h. M7kd or its mutants encoded in pIRES2-EGFP vectors (2.5 µg/dish) were transfected using Lipofectamine 3000 (Invitrogen) according to the manufacturer’s instructions. After an overnight incubation, cells were replated on glass coverslips coated with Matrigel (Corning) and cultured in the growth medium containing doxycycline (1 µg/ml) for 16–30 h.
For baculovirus-mediated expression, HEK293 cells that stably expressed M7cd were plated into a 12-well plate (1.2 × 105 cells/well). The cells were cultured for 15–24 h in 900 µl of growth medium containing doxycycline (1 µg/ml) and 100 µl of baculovirus P2 virus solutions.
HEK293 cells expressing M7kd were identified by EGFP fluorescence under an epifluorescence microscope.
Immunoblotting
Immunoblotting was performed as previously described (Inoue et al., 2014). Proteins in the HEK293 whole-cell lysates were separated by SDS-PAGE using 3–15% linear gradient gels and electrophoretically transferred onto polyvinylidene difluoride membranes. To detect full-length TRPM7, its mutants, and M7cd, rabbit anti-TRPM7 antibody (ACC-047, epitope 1146–1165 of hTRPM7; Alomone Labs) was used. Rabbit anti-TRPM7+TRPM6 antibody (ab109438, epitope 1800 to C terminus of hTRPM7; Abcam) was used to detect M7kd.
Immunocytochemistry
Stable HEK293 cells were plated onto glass coverslips (⌀13 mm) that were coated with Matrigel, and protein expression was induced by doxycycline (1 µg/ml) for 24 h. Cells were fixed in 4% formaldehyde for 10 min at room temperature (RT), washed three times with PBS, and permeabilized in 0.2% Triton X-100 (Sigma-Aldrich) in PBS for 10 min at RT. Cells were washed three times with cold PBS and incubated with 1% BSA in PBS for 10 min and then with goat anti-TRPM7 antibody (ab729; Abcam) for 16 h at 4°C. After three washes with 1% BSA-PBS, cells were incubated with a secondary antibody, FITC-conjugated donkey antigoat IgG (ab6881; Abcam). After three washes with 1% BSA-PBS, coverslips were mounted for confocal microscopic imaging (FluoView version 10; Olympus).
Patch-clamp experiments
All experiments were conducted at RT (23–25°C). The patch electrodes were prepared from borosilicate glass capillaries and had a resistance of 1.5–2.2 MΩ when filled with a pipette solution (see below). Series resistance (<3 MΩ) was compensated (80%) to minimize voltage errors. Currents were recorded using an Axopatch 200B amplifier (Molecular Devices) that was coupled to a DigiData 1550 A/D and D/A converter (Molecular Devices). Current signals were filtered at 1 kHz using a four-pole Bessel filter and were digitized at 5 kHz. pClamp 10.6 software (Molecular Devices) was used for the command pulse protocol, data acquisition, and analysis. The time courses of the current were monitored by repetitively (every 10 s) applying a ramp pulse from −100 to +100 mV (1-s duration) from a holding potential of 0 mV. The control bath solution consisted of (in mM) 135 NaCl, 5 KCl, 1 MgCl2, 1 CaCl2, 1.2 NaH2PO4, 10 HEPES, 2 glucose, and 27 mannitol (pH 7.4 adjusted with NaOH, 315 mOsmol/kgH2O). The intracellular (pipette) solutions were as follows (in mM): 25 CsCl, 110 CsOH, 110 glutamate, 0.2 EGTA, 10 EDTA, and 5 HEPES (pH 7.3 adjusted with CsOH, 290 mOsmol/kgH2O). MgSO4 was added to vary the [Mg2+]. For the intracellular solution containing 20.9 µM or 0.2 mM [Mg2+], EDTA was replaced with HEDTA. For the intracellular solution containing [Mg2+] >0.5 mM, EDTA was eliminated. [Mg2+] was calculated using MaxChelator software (https://somapp.ucdmc.ucdavis.edu/pharmacology/bers/maxchelator/webmaxc/webmaxcS.htm). H2O2 or NMM was applied to the extracellular solution for 4 min, and the current amplitudes were analyzed at the end of the application. The current amplitudes just before the application of H2O2 or NMM were considered to represent the control.
Statistical analysis
Data are presented as the mean ± SEM of the observations. Comparisons of two experimental groups were made using Student’s t test. The time course of the current was compared using repeated-measures ANOVA. Data were considered to be significant at P < 0.05.
The formula for the biphasic concentration–response curves with two IC50 values (IC50(1) and IC50(2), IC50(1) < IC50(2)) and two slopes (slope 1 and slope 2) is as follows:
where p is the fraction of high-affinity inhibition with IC50(1).
Online supplemental material
Fig. S1 shows the time course of whole-cell currents in the presence of various [Mg2+]i and localization of TRPM7 in full-length mTRPM7-wt–overexpressing HEK293 cells and the effect of oxidative stress induced by H2O2 and NMM on the hTRPM7 current. Fig. S2 shows the effect of H2O2 on the current in cells that coexpress the zinc-binding motif mutant M7kds in the presence of 0.8 or 2.8 µM [Mg2+]i. Table S1 includes the number of experiments and exact P values for each mutant channel examined in Fig. 2 C.
Results
mTRPM7 and hTRPM7 were inhibited by H2O2 in an [Mg2+]i-dependent manner
It is well established that the TRPM7 current is inhibited by both extracellular and intracellular Mg2+. Because the extracellular Mg2+ produces voltage-dependent pore block, the inward current is very small in the presence of physiological extracellular divalent cations. Therefore, in our previous studies on overexpressed mTRPM7 current in HEK293 cells and an endogenous TRPM7 current in mouse white adipocytes, the extracellular divalent cations were eliminated to investigate the effect of oxidative stress that was induced by H2O2 on both the outward and inward currents (Inoue et al., 2014; Inoue et al., 2019). H2O2 was shown to inhibit TRPM7 current in a voltage-independent and [Mg2+]i-dependent manner. To confirm these previous observations, we first recorded a whole-cell current in mTRPM7-wt–overexpressing HEK293 cells in the presence of physiological extracellular divalent cations (Fig. 1 A). The current showed spontaneous activation for ∼2 min after establishment of a whole-cell configuration (break-in; Fig. 1 A). This activation was probably due to a reduction of [Mg2+]i from ∼0.9 mM, which was assumed to be in the cytosol, to the [Mg2+] in the pipette solutions because the activation rates seemed to be dependent on the [Mg2+] in the pipette solutions (Fig. S1 A). The I-V relationships showed strong outward rectification, regardless of the existence of intracellular Mg2+ (Fig. 1, B and C). When 500 µM of H2O2, which is a concentration that maximally inhibits TRPM7 (Inoue et al., 2014), was applied to the extracellular solution in the presence of 0.2 mM [Mg2+]i, the outward current was markedly inhibited (200.3 ± 28.1 pA/pF and 22.6 ± 3.8 pA/pF at +80 mV before and 4 min after application of H2O2, respectively; n = 8; Fig. 1, A and B). Although the inward current was very small compared with the outward current due to the existence of extracellular divalent cations, it was also significantly inhibited by H2O2 (−10.4 ± 1.5 pA/pF and −6.0 ± 1.2 pA/pF at −80 mV before and 4 min after application of H2O2, respectively; n = 8). However, the current was completely insensitive to H2O2 in the absence of intracellular Mg2+ (343.0 ± 47.8 pA/pF and 333.4 ± 46.1 pA/pF at +80 mV, −17.9 ± 4.3 pA/pF and −16.1 ± 4.8 pA/pF at −80 mV, before and 4 min after application of H2O2, respectively; n = 14; Fig. 1, A and C). Consistent with previous reports that suggest that TRPM7 has two affinity sites for Mg2+ (Chokshi et al., 2012a; Inoue et al., 2014), the TRPM7 current was inhibited by intracellular free Mg2+ in a concentration-dependent manner with two IC50s (IC50(1) of 5.6 µM and IC50(2) of 558 µM) in the control condition (i.e., before an application of H2O2). H2O2 shifted the [Mg2+]i-dependent inhibition curves to lower concentrations with a single IC50 of 3.4 µM (Fig. 1 D). It has been reported that mTRPM7-S1107E mutant is insensitive to [Mg2+]i (Hofmann et al., 2014; Zhelay et al., 2018). Consistently, the spontaneous current activation after break-in was not observed in mTRPM7-S1107E mutant in whole-cell recordings (Fig. 1 E). Application of H2O2 (500 µM) did not affect mTRPM7-S1107E current even in the presence of higher [Mg2+]i up to 1 mM (Fig. 1 F). These data were consistent with the concept that an H2O2-induced decrease in the current is due to an enhancement of [Mg2+]i-dependent inhibition (hereafter referred to as Mg2+ inhibition). However, it was also possible that H2O2 decreased the amount of TRPM7 on the plasma membrane by inducing channel internalization. To test this possibility, immunocytochemistry was performed to investigate the membrane expression levels of TRPM7 after the treatment with H2O2 in mTRPM7-wt–overexpressing HEK293 cells. It was revealed that mTRPM7-wt was clearly detected at the cell boundaries, suggesting the expression on the plasma membrane (Fig. S1 B). A 5-min treatment with H2O2 (500 µM) did not affect significantly the distribution of TRPM7 on the plasma membrane (Fig. S1 B), suggesting that H2O2 inhibited the TRPM7 current by reducing channel activity (channel open probability and/or unitary conductance) rather than by channel internalization.
Furthermore, it was confirmed that hTRPM7 current was inhibited by H2O2 (500 µM) in a similar [Mg2+]i-dependent fashion (Fig. S1, C and D). These data indicated that mTRPM7 and hTRPM7 channel activities are similarly regulated by oxidative stress.
Cleavage of TRPM7 by caspases was not involved in H2O2-induced TRPM7 inactivation
It has been reported that TRPM7 is cleaved by caspases at position D1510 and that the released TRPM7 kinase domain translocates to the nucleus (Desai et al., 2012; Krapivinsky et al., 2014). The truncated TRPM7 channel domain can be expressed on the plasma membrane (Desai et al., 2012; Duan et al., 2018), although the channel activity is strongly inhibited by intracellular Mg2+ (Schmitz et al., 2003). Because H2O2 activates caspases, it might be possible that caspases mediate the inhibition of TRPM7 by cleaving the kinase domain from TRPM7. To test this possibility, another HEK293 cell line that expressed a caspase cleavage-resistant mutant, TRPM7-D1510A, was established (Fig. 1 G). Similar to TRPM7-wt (Fig. 1 A), TRPM7-D1510A was markedly inhibited by H2O2. These data suggest that caspase-mediated cleavage of TRPM7 is not involved in the current inhibition that occurs at least during short (4-min) exposure to H2O2.
Screening of cysteines involved in H2O2-induced TRPM7 inactivation
Since cysteine is one of the most vulnerable amino acid residues to oxidative stress in proteins, it might be possible that H2O2 oxidizes cysteine(s) in TRPM7 and thereby induces [Mg2+]i-dependent inactivation of the channel activity. Consistent with our previous reports (Inoue et al., 2014), NMM (100 µM), a cysteine-modulating reagent, inhibited mTRPM7 and hTRPM7 in a manner similar to that of H2O2 (Fig. 1, H and I; and Fig. S1 E) without affecting localization on the plasma membrane (Fig. S1 B). We then screened for 34 cysteines that are conserved in both mTRPM7 and hTRPM7 (Fig. 2 A) by using site-directed mutagenesis to identify the oxidation targets during exposure to H2O2. HEK293 cell lines that stably express each mutant in response to doxycycline treatment were established. The protein expression of each mutant, including a mutant lacking 55 N-terminal amino acids that contained 7 cysteines (ΔNt7C) as well as single- or double-point mutants of cysteine (C) replaced with alanine (A), was confirmed by Western blotting using whole-cell lysate of doxycycline-treated (Dox[+]) HEK293 cells (Fig. 2 B). All alanine mutants, except those at the positions C721, C738, C1809, and C1813, expressed robust currents that were significantly larger than endogenous currents in doxycycline-untreated (Dox[−]) HEK293 cells in the presence of 0.2 mM [Mg2+]i (Fig. 2 C and Table S1). The current amplitudes in the control conditions were varied among mutants, but H2O2 consistently decreased the currents to ∼30% of those before H2O2 treatment in each mutant, suggesting that these cysteines are not the target for oxidation by H2O2 to inhibit the current (Fig. 2 C). Although TRPM7-C721A, -C738A, -C1809A, and -C1813A protein expression was detected in whole-cell lysates by Western blotting (Fig. 2 B), the current amplitude in these mutants was indistinguishable from that in Dox[−] cells (Fig. 2 C).
Consistent with the electrophysiological results, immunocytochemistry revealed that TRPM7-C721A and -C738A seemed to be retained in the intracellular compartments but were not expressed on the plasma membrane (Fig. 3). Instead of alanine mutants, serine mutants of C721 and C738 could be expressed on the plasma membrane (Fig. 3) and exhibited a robust current that was sensitive to H2O2 (Fig. 2 C). However, a serine mutant of C1809 and C1813, which are both located in the zinc-binding motif at the C terminus and are important for structural integrity of the TRPM7 kinase domain (Runnels et al., 2001; Yamaguchi et al., 2001), were not expressed on the plasma membrane (Fig. 3).
M7cd was functionally expressed in HEK293 cells
Because the cysteine mutations in the zinc-binding motif of TRPM7 interfered with membrane expression, we developed a novel approach in which the full-length TRPM7 was functionally reconstituted by coexpressing M7cd and M7kd as separate proteins in a cell.
We established an HEK293 cell line that stably expresses M7cd (aa 1–1509). Whole-cell recordings confirmed the functional expression of M7cd on the plasma membrane in the absence of intracellular Mg2+ (Fig. 4 A, open circles). The current exhibited activation after break-in followed by a rapid rundown in the presence of intracellular Mg2+ in M7cd-expressing cells (Fig. 4 A). Although the rundown of the current continued during 6-min recording, the current amplitude was still dependent on [Mg2+]i (Fig. 4 B). Therefore, a concentration–response curve was constructed using the current amplitude at 2 min after break-in (Fig. 4 C). Consistent with the previous report, which demonstrated that TRPM7-Δkinase (deletion after aa 1569) is strongly inhibited by intracellular Mg2+ (Schmitz et al., 2003), it was revealed that the M7cd current was inhibited by intracellular Mg2+ with an IC50 of 3.0 µM (Fig. 4 C). However, M7cd that carries an S1107E mutation (M7cd-S1107E) expressed robust currents constantly in the absence or presence of 0.2 mM [Mg2+]i (192.5 ± 18.3 pA/pF and 217.9 ± 26.9 pF/pA at +80 mV at 2 min after break-in, in the absence or presence of 0.2 mM [Mg2+]i, n = 10 and 7, respectively; Fig. 4 D). These results suggest that the loss of the kinase domain augmented the Mg2+ inhibition of TRPM7 channel activity.
The effect of H2O2 on M7cd was tested in the absence or presence of intracellular Mg2+ (Fig. 4, E and F). When we compared it with full-length TRPM7-wt (Fig. 1 A), M7cd current seemed to slightly decrease by an application of H2O2 (500 µM) in the absence of intracellular Mg2+, but there was no statistically significant interaction between the control and H2O2-treated conditions (Fig. 4, A and E; repeated-measures ANOVA, P = 0.786). Inclusion of Mg2+ in the intracellular solution induced rundown even at low concentrations (<1 µM; Fig. 4 F). H2O2 treatment did not significantly affect the time course of current decrease (Fig. 4 F; P = 0.247). Taken together with the results that cysteine mutations in M7cd did not affect the oxidative stress response (Fig. 2), these data suggest that M7cd is not the target for H2O2 to enhance Mg2+ inhibition of TRPM7.
Functional reconstitution of TRPM7 by coexpression of M7cd and M7kd
To test the effect of M7kd coexpression on the M7cd current, M7kd (aa 1511–1863) was separately expressed in M7cd-expressing HEK293 cells. In M7cd and M7kd–coexpressing cells, the spontaneous current activation after break-in was similar to full-length TRPM7-wt in both the absence and presence of 0.2 mM [Mg2+]i (Fig. 5 A). H2O2 (500 µM) significantly inhibited the reconstituted current in the presence of 0.2 mM [Mg2+]i (565.7 ± 68.9 pA/pF and 14.0 ± 3.2 pA/pF at +80 mV before and 4 min after application of H2O2, respectively; n = 8), but not in the absence of Mg2+ (1,226.1 ± 240.2 pA/pF and 852.5 ± 184.9 pA/pF at +80 mV before and 4 min after application of H2O2, respectively; n = 8; Fig. 5, A–C). The concentration–response data of the reconstituted current can be fitted by the formula for a biphasic curve, and this provides an IC50(1) of 7.6 µM and an IC50(2) of 986 µM (Fig. 5 D), which were comparable to that of full-length TRPM7-wt (Fig. 1 D). Similar to full-length TRPM7-wt, a 4-min treatment with H2O2 (500 µM) shifted the curve leftward, with a single IC50 of 3.0 µM (Fig. 5 D). Thus, M7kd attenuates Mg2+ inhibition, and reconstitutes a full-length TRPM7-like current that conserves sensitivity to oxidative stress, regardless of whether it is tethered to the TRPM7 channel domain.
During whole-cell recordings in M7cd-expressing HEK293 cells that were transfected with M7kd expression vector by lipofection, the current sometimes decreased after spontaneous activation before application of H2O2 (Fig. 5, A and E, closed circles). Because M7kd was expressed as a cytosolic mobile protein rather than as a plasma membrane–anchored protein, it could be easily diluted with the pipette solutions during whole-cell recordings. Thus, the decrease in the current might result from a decrease in M7kd after break-in. Consistently, when M7kd was expressed with a baculovirus vector that was supposed to enable highly efficient M7kd expression, the current was maintained at least during 6-min recordings (Fig. 5 E, open squares). It was suggested that the amount of M7kd was sufficient even after dilution with the pipette solution when M7kd was expressed with a baculovirus vector. H2O2 (500 µM) and NMM (100 µM) inhibited the reconstituted current in HEK293 cells that coexpressed M7cd and M7kd by baculovirus transfection (Fig. 5, F and G). Therefore, transfection of M7kd with either lipofection or the baculovirus could reconstitute a comparable full-length TRPM7.
Kinase activity was not involved in the M7kd-mediated regulation of Mg2+ inhibition of M7cd
We previously reported that a full-length, kinase-inactive point mutant TRPM7-K1645R is inhibited by H2O2 in a manner similar to that of TRPM7-wt (Inoue et al., 2014). Coexpression of M7kd-K1645R in M7cd-expressing cells also generated a substantial current that was inhibited by H2O2 (500 µM; Fig. 5 H), indicating reconstitution of the full-length TRPM7-K1645R. It is suggested that the kinase activity is not essential to relieve M7cd from Mg2+ inhibition. Consistent results were obtained when M7cd was coexpressed with a kinase domain of TRPM6 (M6kd), which is the closest homologue of TRPM7, but their kinase functions are not redundant (Schmitz et al., 2005; Fig. 5 I). M6kd (aa 1650–2028) could also attenuate Mg2+ inhibition of M7cd, possibly because of their structural similarity, such as the presence of a zinc-binding motif at the C terminus. The reconstituted current was also inhibited by H2O2 (500 µM; Fig. 5 I).
Mutations of cysteines in the zinc-binding motif interfered with the functional interaction between M7cd and M7kd, which attenuated Mg2+ inhibition of TRPM7 current
To examine the effect of mutations of C1809 and C1813, M7kd-C1809S or -C1813S was coexpressed in M7cd-expressing HEK293 cells. M7cd and M7kd protein expression was confirmed by Western blotting of whole-cell lysates using different antibodies targeting M7cd (ACC-047) and M7kd (ab109438; Fig. 6 A). M7kd-wt and the mutants M7kd-C1809S and -C1813S were expressed in HEK293 cells stably expressing M7cd. The functional expression of M7cd on the plasma membrane was also confirmed in cells coexpressing M7cd and mutant M7kd by the whole-cell recordings in the absence of intracellular Mg2+ (Fig. 6, B and C, open circles).
In these settings, coexpression of M7kd-C1809S or -C1813S did not attenuate the Mg2+ inhibition of the M7cd current (Fig. 6, B–D and I). The [Mg2+]i-dependent curves in M7kd-C1809S– or -C1813S–coexpressing cells were similar to those in cells expressing M7cd alone (IC50 of 8.9 µM for M7kd-C1809S and 8.0 µM for M7kd-C1813S; Fig. 6 D). The time courses of the currents for M7kd-C1809S– or -C1813S–coexpressing cells were similar to those in cells expressing M7cd alone, in which the current rapidly decreased in the presence of intracellular Mg2+ even at low concentrations (2.8 µM and 0.8 µM; black squares in Fig. 6 E and Fig. S2, A, D, and E). Furthermore, H2O2 treatment did not significantly affect the time course of the current (red circles in Fig. 6 E and Fig. S2, A, D, and E). Coexpression of M7kd-C1809S did not affect M7cd-S1107E (Mg2+-insensitive mutant) current either before or after an application of H2O2 (500 µM; Fig. 6 F), suggesting that the mutation of C1809 in M7kd does not have a direct inhibitory effect on the current, per se.
The crystal structure of the TRPM7 kinase domain (aa 1521–1863) reveals that a zinc atom is coordinated by H1750, H1807, C1809, and C1813 (Yamaguchi et al., 2001). Therefore, we examined the involvement of H1750 and H1807 in the Mg2+ inhibition of the M7cd current (Fig. 6, G–I; and Fig. S2, B, C, F, and G). Coexpression of M7kd-H1750A or -H1807A failed to reconstitute the full-length TRPM7, indicating that the structural integrity of M7kd supported by the zinc-binding motif is important for attenuating the Mg2+ inhibition of M7cd.
Thus, it is indicated that the zinc-binding motif plays a key role in the functional interaction between M7cd and M7kd in attenuating the Mg2+ inhibition of the channel activity. Our data suggest that the oxidation of C1809 or C1813 by H2O2 disrupts the functional interaction between the channel domain and the kinase domain to enhance the Mg2+ inhibition of the TRPM7 channel.
Discussion
In the present study, we found novel mechanisms that support the regulation of TRPM7 channel activity by its kinase domain (Fig. 7). It was revealed that intramolecular interactions between the channel domain and the kinase domain increase the TRPM7 current by attenuating TRPM7 inhibition by intracellular Mg2+. Mutations of residues in the zinc-binding motif (H1750A, H1807A, C1809, and C1813), which are important for the structural integrity of the kinase domain, diminished the effects of the kinase domain on the TRPM7 current. Our data suggest that oxidative stress inhibits TRPM7 probably via oxidation of C1809 and/or C1813. Oxidation of these cysteines might disrupt the proper structure of the kinase domain and interfere with the interaction between the channel domain and the kinase domain to enhance the inhibition of TRPM7 by intracellular Mg2+.
Oxidation of cysteines and methionines in proteins regulates numerous redox-sensitive physiological functions (Rhee et al., 2000; Poole and Nelson, 2008; Reddie and Carroll, 2008; Klomsiri et al., 2011). Among TRPM family members, TRPM2 and TRPM6 have been reported to be regulated by oxidative stress via direct oxidation of a certain methionine residue (Cao et al., 2010; Kashio et al., 2012). Our present study suggests that C1809 and C1813 act as an oxidative stress sensor in TRPM7. The crystal structure of the TRPM7 kinase domain has revealed that these cysteines coordinate a zinc ion with H1750 and H1807 (Yamaguchi et al., 2001). This zinc-binding motif is important for the structural integrity of the TRPM7 kinase domain, and thus, mutation of C1809 and C1813 results in a loss of kinase activity (Runnels et al., 2001). Because the kinase-inactive M7kd-K1645R as well as M6kd, which is a functionally nonredundant kinase to the TRPM7 kinase (Schmitz et al., 2005), attenuated the Mg2+ inhibition of M7cd current in a manner that was comparable to that of M7kd-wt (Fig. 5, H and I), the kinase activity is not likely involved in the regulation of [Mg2+]i sensitivity. However, M7kd-C1809 or -C1813 failed to attenuate the Mg2+ inhibition of the M7cd current (Fig. 6, B–D and I). Furthermore, our experiments showed that M7kd-H1750A or -H1807A also failed to attenuate the Mg2+ inhibition of the M7cd current (Fig. 6, G–I). On the basis of these results, it is suggested that the structural integrity of the TRPM7 kinase domain that is guaranteed by the zinc-binding motif is important for the interaction between the channel domain and the kinase domain to regulate the [Mg2+]i sensitivity of TRPM7. It has been proposed that the zinc-binding motif acts as an oxidative stress sensor in various proteins to regulate cellular functions in response to redox changes (Ilbert et al., 2006; Kröncke and Klotz, 2009). Similarly, the zinc-binding motif of TRPM7 might be an oxidative sensor that regulates the channel activity.
To induce oxidative stress, 500 µM H2O2 was added to the extracellular solutions in the present study. It might be questionable that such high concentrations can occur in vivo. It has been reported that a gradient between extracellular and intracellular H2O2 concentrations is 390-fold (Lyublinskaya and Antunes, 2019) or 650-fold (Huang and Sikes, 2014), with the lower concentrations in the cytosol. Thus, [H2O2]i was estimated to be ∼0.8–1.3 µM when 500 µM H2O2 was applied to the extracellular solution. Such submicromolar intracellular H2O2 has been shown to mediate the redox signaling under pathological conditions (Sies, 2017). Furthermore, extracellular H2O2 inhibits TRPM7 with an IC50 of 15.9 µM (Inoue et al., 2014), suggesting that H2O2 might oxidize C1809 and/or C1813 even within the range of physiological concentrations ([H2O2]i = 1–10 up to 100 nM). Thus, regulation of the TRPM7 channel activity by H2O2 is a mechanism that may occur under both physiological and pathophysiological conditions.
In our electrophysiological experiments, EDTA or HEDTA was included in the pipette solutions to maintain constant [Mg2+]i even under conditions where Mg2+ can influx due to channel activity (i.e., in the presence of extracellular Mg2+), when the [Mg2+]i was set at <0.5 mM (see Materials and methods). In addition to Mg2+, these chelators bind Zn2+ with a Kd of 2.3 × 10−14 M (EDTA) or 6.6 × 10−13 M (HEDTA), respectively (Krężel and Maret, 2016). Therefore, the use of these chelators might unfold the zinc-binding motif of TRPM7 by depleting a zinc ion under the whole-cell configuration. However, we were able to measure a robust TRPM7 current in the presence of the chelators (Fig. 1), suggesting that the TRPM7 zinc-binding motif provides a high-affinity binding site for zinc. Similarly, an extracellular application of a membrane-permeable, zinc-specific chelator, TPEN (Kd = 6.4 × 10−16 M), did not cause marked TRPM7 inhibition as did H2O2 in our preliminary experiments (135.3 ± 14.5 pA/pF and 89.0 ± 9.1 pA/pF at +80 mV before and 4 min after application of 100 µM TPEN, respectively; n = 12). It has been reported using zinc finger peptide models that a well-packed hydrophobic core in the vicinity of a zinc-binding motif increases the Ka to 1013–1016 M and slows down the kinetics of metal exchange (Sénèque and Latour, 2010). In the TRPM7 zinc-binding motif, a zinc atom is integrated into the hydrophobic core and is secluded from solvent (Yamaguchi et al., 2001). Thus, the zinc-binding motif of TRPM7 might be folded as intact, even in the presence of the chelators, until H2O2 is applied.
Our results demonstrated that M7cd and M7kd interact functionally, but the interaction sites of M7cd with M7kd remain to be identified. Electrophysiological data suggested weak binding between M7cd and M7kd (Fig. 5 E). When M7kd was overexpressed in M7cd-expressing cells as a separated individual protein, the current was robust for several minutes after break-in but decreased over time (Fig. 5 E). This might be due to a decrease in M7kd concentration in the cytosol through intracellular perfusion with the pipette solution. Thus, because of the weak binding of M7cd and M7kd, it is difficult to identify the interaction sites via a general immunoprecipitation technique or a pull-down assay. FRET experiments may be an effective approach to confirm the interaction. Alternatively, structural analysis might be more effective for clarifying the detailed mechanism underlying the interaction. To date, the structure of the TRPM7 channel domain (lacking the kinase domain) and that of the TRPM7 kinase domain (lacking the channel domain) have been resolved independently (Yamaguchi et al., 2001; Duan et al., 2018). However, the whole structure of TRPM7 remains to be identified. Thus, further structural study is necessary to identify the interaction sites between M7cd and M7kd that regulate the channel activity.
It has been proposed that TRPM7 has two intracellular Mg2+ sites to inhibit its channel activity (Nadler et al., 2001; Monteilh-Zoller et al., 2003; Chokshi et al., 2012a, 2012b). Consistent with this idea, the concentration–response data for the full-length TRPM7-wt in our study were well explained by two binding sites for Mg2+: a high-affinity site (IC50(1) < 10 µM) and a low-affinity site (IC50(2) > 500 µM; Fig. 1 D). The present study revealed that M7cd has a single affinity site with an IC50 of 3.0 µM that is quite similar to the IC50(1) of full-length TRPM7 (Fig. 4 C). Thus, it is suggested that the high-affinity Mg2+ site is located in M7cd, whereas the low-affinity site is located in M7kd. From the results that H2O2 both shifted the [Mg2+]i-dependent inhibition curves to lower concentrations and converted it to a monophasic curve with IC50 of 3.4 µM (highly similar to that of M7cd), it seems as if H2O2 removed M7kd from the full-length TRPM7-wt. Because the cleavage-resistant mutant, TRPM7-D1510A, remained sensitive to oxidative stress (Fig. 1 G), H2O2 might completely interfere with the functional interaction between the channel domain and the kinase domain by oxidizing C1809 and/or C1813 rather than by physically cleaving it. It can be also speculated that attenuation of Mg2+ inhibition by M7kd is not due to reduction of Mg2+ binding affinity to the site in M7cd, because the full-length TRPM7 retains the high-affinity Mg2+ binding. From the fitting, the fraction of Mg2+ inhibition that is related to the high-affinity Mg2+ binding is estimated to be ∼30% of maximal Mg2+ inhibition in full-length TRPM7 (Fig. 1 D). Therefore, M7kd might reduce the transduction from the high-affinity Mg2+ binding to channel inhibition by ∼70%. Because M7kd has a low-affinity site for Mg2+, the remaining 70% of Mg2+ inhibition is induced at high concentrations of Mg2+. Thus, H2O2 inhibits TRPM7 via an apparent enhancement of Mg2+ inhibition.
Mutation of cysteines in the zinc-binding motif as well as the alanine mutants of C721 and C738 in full-length TRPM7 were not expressed on the plasma membrane and instead remained at an intracellular compartment (Fig. 3). The results suggest that these cysteines might be important for proper folding of TRPM7 to be expressed on the plasma membrane. A heterozygous mutation of C721 to glycine in TRPM7 has been found in a human pedigree with macrothrombocytopenia (Stritt et al., 2016). In contrast to TRPM7-C721A, which was examined in the present study, the TRPM7-C721G mutant is successfully expressed on the plasma membrane, though the current is reduced by 85% of that of TRPM7-wt when expressed in HEK293 cells. The serine mutant of C721 (TRPM7-C721S) could be expressed on the plasma membrane (Fig. 3), and the current was comparable to that of TRPM7-wt (Fig. 2 C). Thus, the results vary based on which amino acid is substituted for C721. The structure defined by C721 might be important for expression on the plasma membrane and for TRPM7 channel activity, but it may not be involved in the oxidative stress–induced inhibition of TRPM7.
There has been an increasing amount of interest in investigating the involvement of TRPM7 channel activity in a range of pathologies, such as ischemia in the brain (Aarts et al., 2003; Sun et al., 2009; Chen et al., 2015a) and kidney (Meng et al., 2014; Liu and Yang, 2019), as well as in cancer (Guilbert et al., 2009; Rybarczyk et al., 2012; Chen et al., 2015b; Liu et al., 2020). Down-regulation of TRPM7 by siRNA or TRPM7 inhibitors alleviates ischemic damage in neurons (Chen et al., 2015a; Sun, 2017). Because TRPM7 is permeable to divalent cations, including Ca2+ and Zn2+, it is conceivable that down-regulation of TRPM7 protects cells from Ca2+- or Zn2+-induced toxicity that is associated with ischemia (Inoue et al., 2010; Sun, 2017). In cancer cells, it has been reported that increased activity of TRPM7 might be involved in cancer cell proliferation and migration (Guilbert et al., 2009; Rybarczyk et al., 2012; Chen et al., 2015b). Thus, down-regulation of TRPM7 might be a therapeutic target under these pathological conditions. There are several potent inhibitors of TRPM7, such as waixenecin A (Zierler et al., 2011) and NS8593 (Chubanov et al., 2012), but the binding site of these compounds in the TRPM7 molecule remains largely unknown. Both waixenecin A and NS8593 inhibit TRPM7 current in the absence of intracellular Mg2+ or its kinase domain, thus the inhibitory mechanisms are different from those of oxidative stress. Based on our present findings, compounds that are designed to interrupt the intramolecular interaction between the channel domain and the kinase domain can be specific inhibitors of TRPM7.
In conclusion, oxidative stress inhibits TRPM7 channel activity. Cysteine residues of the zinc-binding motif are suggested to act as the oxidative stress sensor, and their oxidation might interfere with the intramolecular interactions between the channel domain and the kinase domain, thereby increasing Mg2+-dependent inhibition of the channel activity.
Acknowledgments
Crina M. Nimigean served as editor.
We thank Dr. N. Fukushima for useful discussions.
This work was supported in part by Japan Society for the Promotion of Science grants-in-aid for scientific research (25460302, 21K09112, and 17K08549 to H. Inoue and 19H03404 to H. Inoue and T. Murayama), the Japan Agency for Medical Research and Development Platform Project for Supporting Drug Discovery and Life Science Research (Basis for Supporting Innovative Drug Discovery and Life Science Research; JP20am0101080, support number 0743, to T. Murayama), and the Tokyo Medical University Research Support Program during Life Events (to H. Inoue).
The authors declare no competing financial interests.
Author contributions: H. Inoue performed the electrophysiological experiments and cell biological experiments. T. Murayama and T. Kobayashi provided experimental tools and performed biochemical experiments. H. Inoue and T. Murayama analyzed the data. H. Inoue, T. Murayama, M. Konishi, and U. Yokoyama wrote the manuscript. All authors discussed the results and approved the final version of the manuscript.
References
Author notes
H. Inoue and T. Murayama contributed equally to this paper.
![Screening of cysteines in mTRPM7 that were responsible for the oxidative stress–induced inhibition.(A) Schematic diagram of 34 cysteines that are conserved in mTRPM7 and hTRPM7. S1107 and D1510 are also depicted (red dots). (B) Expression of TRPM7-wt and its mutants. Immunoblotting of TRPM7 and calnexin (loading control) was performed with HEK293 whole-cell lysates. Numbers on the left represent molecular mass of standards (in kD). (C) The effect of H2O2 (500 µM) on mutant TRPM7 current at 0.2 mM [Mg2+]i. Each bar represents the mean ± SEM (vertical bar). *, P < 0.05 by unpaired t test versus Dox[−] cells. The number of observations (n) and exact P values for each mutant are shown in Table S1.](https://cdn.rupress.org/rup/content_public/journal/jgp/153/6/10.1085_jgp.202012708/2/m_jgp_202012708_fig2.png?Expires=1767773132&Signature=guj0WTmm8tcnJhmb0RKgoubNiFb5w7~ACVavPlCOzhFksgT5lG~beFOctKOE-S9-VOLZTncpzGCO86zLr3l5TRHXUykMOqYIJnn4oHdt5peFJv4YsUuPpQT2ExnEdD7AUrm3vDknYbuZvJtJWjp0JJ84LXH0AanYGyirCp6l02YPJjMRH12C-lzRG3d7J2RpsGXi7Oop-eMQCABBBPLKLBwOlophwbiz5UbLl6JLn~8rzMCaOwJW~zEh9cLIb3UpCHYFeDOIRFFqhYITd3i-GKDlHncupvz88~Shzhq6tqVyUczWyZpivdZNuIUVkP2xDVpzE6MHdX6O~w8S2Fh-WA__&Key-Pair-Id=APKAIE5G5CRDK6RD3PGA)