Figure S1.

16% SDS-PAGE gel for UN2A. The titin gene sequence of the UN2A region was commercially synthesized by GeneArt (Invitrogen) and encompasses amino acids 8539 to 8655 in the mouse titin sequence (GenBank accession no. NM_011652.3), which shares 95% identity with the human UN2A sequence (111 out of the 117 amino acids are identical). Sequence for UN2A: DERKKQEKIEGDLRAMLKKTPALKKGSGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLK QSQEEETHRLEIEELEKSERDEKEFEELVAFIQQRLTQTEPVTLIKD. Source data are available for this figure: SourceData FS1.

or Create an Account

Close Modal
Close Modal