Table 3.
Early escape in the VNC child 517-C develops in non-Gag epitopes
SubjectChild's ageC*03 Gag 296YL9304FrequenceyB*42 Nef 71RM979FrequencyA*30 Pol 328AY9366FrequencyA*30 Env 704IY9712FrequencyA*30 Env 794KY9802FrequencyB*42 Env 298RI10307FrequencyB*42 Env 843IF9851FrequencyB*15:10 Rev 52IL960FrequencyB*15:10 Vif 78WI987aFrequency
YVDRFFKTLRPQVPLRPMAQNPEIVIYIVNRVRQGYKYLGSLVQYRPNNNTRKSIIPRRIRQGFIHSISERILDWHLGHGVSI
 yr                   
517-M 0.25 ········· 100% ········· 100% ········· 100% V·R······ 68% ········· 100% ·········· 85% L········ 86% ········· 100% ·········· 100% 
        V·S······ 22%   ·······R·· 15% L···V···· 13%     
        V········ 4%           
        I·S······ 3%           
 ········· 100% ········· 100% ········· 93% V·R······ 97% ········· 100% ·········T 55% L········ 36% ········· 100% ·········· 100% 
      ·R······· 4% V·RK····· 2%   ·········V 29% L···L···· 29%     
      ·K······· 2%     ··S······V 13% L···F···· 29%     
            ··S······I 1.6% L···V···· 5%     
517-C 0.2 ········· 100% ········· 100% ········· 53% ··K······ 100% ····N··L· 100% ·TG····R·· 100% ········L 100% ·RA······ 94% ·········· 40% 
      ········C 47%         ·RA·····I 6% ·······A·· 36% 
                  E········· 18% 
                  ··Q······· 2% 
                  ··L······· 2% 
                  ·······I·· 1.1% 
 2.5 ········· 98% ········· 100% ········· 88% V·R······ 98.6% ········· 91% ··G····R·· 51% L········ 100% ·N······· 76% E········· 61% 
  ······R·· 2%   ·····L··· 12% V·RK····· 1.2% ····N···· 9% ··G······· 40%   ·RA······ 12% ·······A·· 30% 
            ··S······· 9%   ·H······· 10% E······A·· 5% 
                LN······· 1.3% ·········· 4% 
 ········· 58% ········· 100% ·····L··· 82% V·R······ 86% ········· 91% ··G····R·· 82% L········ 96% ·N······· 59% E········· 70% 
  ·······V· 39%   ········· 16% ··R······ 13% ····N···· 9% ··G····R·M 14% L···V···· 3% ·N·L····· 17% ·······A·· 25% 
  ·······A· 3%   T····L··· 2%     ··S····R·· 2%   LN······· 11% E······A·· 5% 
                ·H······· 7%   
                ·RA······ 4%   
                VN······· 2%   
 8.5 ·······V· 75% ········· 100% ·····L··· 55% V·R······ 97% ········· 98% ··G····R·T 69% L········ 49% LN······· 71% E········· 61% 
  ········· 22%   ········· 41% V·RK····· 1.5% ····N···· 2% ··G····R·· 31% L·T······ 21% ·N·L····· 21% E······A·· 22% 
  ······R·· 1.6%   T····L··· 2% ··R······ 1.2%     L···L···· 17% ·N······· 7% ·······A·· 17% 
  ·······A· 1.5%           L···F···· 14%     
HLA association  HLA-C*03  HLA-B*42                
Escape variant  Y303X  R71X                
q value  4 × 10-18                  

Mother 517-M: A*30:02+ B*42+/B*15:10− C*03-ve. Child 517-C: A*30:02+ B*42+/B*15:10+ C*03+. Footprints associated with the HLA class I allele are indicated below the table; known escape variants and q values indicating significance of an HLA-polymorphism association are shown (Carlson et al., 2014). 517-M indicates mother of the child 517-C. Frequency represents percentage at which a particular haplotype is present at the indicated time point.

a

HLA-B*15:10–restricted Vif epitope is WI9 (WHLGHGVSI, residues 79–87; in bold), but HLA-B*15:10–associated polymorphisms are at the residue 85 (V85A) within the epitope and at the residue 78 (D78E) upstream of the epitope.

or Create an Account

Close Modal
Close Modal