Table 3.
Early escape in the VNC child 517-C develops in non-Gag epitopes
SubjectChild's ageC*03 Gag 296YL9304FrequenceyB*42 Nef 71RM979FrequencyA*30 Pol 328AY9366FrequencyA*30 Env 704IY9712FrequencyA*30 Env 794KY9802FrequencyB*42 Env 298RI10307FrequencyB*42 Env 843IF9851FrequencyB*15:10 Rev 52IL960FrequencyB*15:10 Vif 78WI987aFrequency
YVDRFFKTLRPQVPLRPMAQNPEIVIYIVNRVRQGYKYLGSLVQYRPNNNTRKSIIPRRIRQGFIHSISERILDWHLGHGVSI
 yr                   
517-M 0.25 ········· 100% ········· 100% ········· 100% V·R······ 68% ········· 100% ·········· 85% L········ 86% ········· 100% ·········· 100% 
        V·S······ 22%   ·······R·· 15% L···V···· 13%     
        V········ 4%           
        I·S······ 3%           
 ········· 100% ········· 100% ········· 93% V·R······ 97% ········· 100% ·········T 55% L········ 36% ········· 100% ·········· 100% 
      ·R······· 4% V·RK····· 2%   ·········V 29% L···L···· 29%     
      ·K······· 2%     ··S······V 13% L···F···· 29%     
            ··S······I 1.6% L···V···· 5%     
517-C 0.2 ········· 100% ········· 100% ········· 53% ··K······ 100% ····N··L· 100% ·TG····R·· 100% ········L 100% ·RA······ 94% ·········· 40% 
      ········C 47%         ·RA·····I 6% ·······A·· 36% 
                  E········· 18% 
                  ··Q······· 2% 
                  ··L······· 2% 
                  ·······I·· 1.1% 
 2.5 ········· 98% ········· 100% ········· 88% V·R······ 98.6% ········· 91% ··G····R·· 51% L········ 100% ·N······· 76% E········· 61% 
  ······R·· 2%   ·····L··· 12% V·RK····· 1.2% ····N···· 9% ··G······· 40%   ·RA······ 12% ·······A·· 30% 
            ··S······· 9%   ·H······· 10% E······A·· 5% 
                LN······· 1.3% ·········· 4% 
 ········· 58% ········· 100% ·····L··· 82% V·R······ 86% ········· 91% ··G····R·· 82% L········ 96% ·N······· 59% E········· 70% 
  ·······V· 39%   ········· 16% ··R······ 13% ····N···· 9% ··G····R·M 14% L···V···· 3% ·N·L····· 17% ·······A·· 25% 
  ·······A· 3%   T····L··· 2%     ··S····R·· 2%   LN······· 11% E······A·· 5% 
                ·H······· 7%   
                ·RA······ 4%   
                VN······· 2%   
 8.5 ·······V· 75% ········· 100% ·····L··· 55% V·R······ 97% ········· 98% ··G····R·T 69% L········ 49% LN······· 71% E········· 61% 
  ········· 22%   ········· 41% V·RK····· 1.5% ····N···· 2% ··G····R·· 31% L·T······ 21% ·N·L····· 21% E······A·· 22% 
  ······R·· 1.6%   T····L··· 2% ··R······ 1.2%     L···L···· 17% ·N······· 7% ·······A·· 17% 
  ·······A· 1.5%           L···F···· 14%     
HLA association  HLA-C*03  HLA-B*42                
Escape variant  Y303X  R71X                
q value  4 × 10-18                  

Mother 517-M: A*30:02+ B*42+/B*15:10− C*03-ve. Child 517-C: A*30:02+ B*42+/B*15:10+ C*03+. Footprints associated with the HLA class I allele are indicated below the table; known escape variants and q values indicating significance of an HLA-polymorphism association are shown (Carlson et al., 2014). 517-M indicates mother of the child 517-C. Frequency represents percentage at which a particular haplotype is present at the indicated time point.

a

HLA-B*15:10–restricted Vif epitope is WI9 (WHLGHGVSI, residues 79–87; in bold), but HLA-B*15:10–associated polymorphisms are at the residue 85 (V85A) within the epitope and at the residue 78 (D78E) upstream of the epitope.

or Create an Account

Close subscription notice
Close access options