Skip to Main Content
Table I.

The new identified histone variants

Name
Accession no.
Length (aa)
% Similarities (% Identities)
Sequence
H2AL1 AAH87913 105 65 (30) with H2A; 83 (75) with H2AL2 MAKKMQRRRRQKRTRSQRGELPFSLVDRFLREEFHSSRLSSSALSFLTSVLEYLTSNIL
     ELAGEVAQTTGRKRIAPEDVRLVVQNNEQLRQLFKPGGTSVNEDDN 
H2AL2 NP_080903 111 75 (41) with H2A; 83 (75) with H2AL1 MARKRQRRRRRKVTRSQRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLT
     SNILELAGEVAHTTGRKRIAPEHVCRVVQNNEQLHQLFKQGGTSVFEPPEPDDN 
H2AL3 NP_080372 117 60 (24) with H2A MSEKKSQEKPCSDNNQIEDPSSRPEVQVPVNYVYRILQEEQYTPCIGSTTSDFLL
     AMLDYLTDYILEVVGSEANINNQQNISQDRERQRDNDREPSRGFKNAPFSLFD
     EMPGPRRNG 
H2BL1 XP_127485 123 72 (38) with H2B; 82 (58) with SubH2Bv MAKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGIS
     SYSVDIMNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATL AVTFGSKAVHRFIHS 
H2BL2 BAB24353 224 64 (31) with H2B MASTTAMDVLEELSSDSSEKQVQPRKPEKAKREKDKPKKGGPEKKAKKEKQEK
     AKPEKKPKKKPEKEKPEGEKLEKKPKKDKREKAKPKKKPEQENREQETPEQEKPE
     VQRRRSLHQSIREDERRARLIRRRKNSFAIYFPKVLKNIHVGLSLSQRSVNILDSFVK
     DMFERIASEASFLARQARNSTINSREIQTAIRLLLPGELCRRAVAEGTMAMVRYISNK 
Name
Accession no.
Length (aa)
% Similarities (% Identities)
Sequence
H2AL1 AAH87913 105 65 (30) with H2A; 83 (75) with H2AL2 MAKKMQRRRRQKRTRSQRGELPFSLVDRFLREEFHSSRLSSSALSFLTSVLEYLTSNIL
     ELAGEVAQTTGRKRIAPEDVRLVVQNNEQLRQLFKPGGTSVNEDDN 
H2AL2 NP_080903 111 75 (41) with H2A; 83 (75) with H2AL1 MARKRQRRRRRKVTRSQRAELQFPVSRVDRFLREGNYSRRLSSSAPVFLAGVLEYLT
     SNILELAGEVAHTTGRKRIAPEHVCRVVQNNEQLHQLFKQGGTSVFEPPEPDDN 
H2AL3 NP_080372 117 60 (24) with H2A MSEKKSQEKPCSDNNQIEDPSSRPEVQVPVNYVYRILQEEQYTPCIGSTTSDFLL
     AMLDYLTDYILEVVGSEANINNQQNISQDRERQRDNDREPSRGFKNAPFSLFD
     EMPGPRRNG 
H2BL1 XP_127485 123 72 (38) with H2B; 82 (58) with SubH2Bv MAKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGIS
     SYSVDIMNILINDIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATL AVTFGSKAVHRFIHS 
H2BL2 BAB24353 224 64 (31) with H2B MASTTAMDVLEELSSDSSEKQVQPRKPEKAKREKDKPKKGGPEKKAKKEKQEK
     AKPEKKPKKKPEKEKPEGEKLEKKPKKDKREKAKPKKKPEQENREQETPEQEKPE
     VQRRRSLHQSIREDERRARLIRRRKNSFAIYFPKVLKNIHVGLSLSQRSVNILDSFVK
     DMFERIASEASFLARQARNSTINSREIQTAIRLLLPGELCRRAVAEGTMAMVRYISNK 

MS peptides are indicated by underlining.

Close Modal

or Create an Account

Close Modal
Close Modal