Phosphorylation of the voltage-gated Na+ (NaV) channel NaV1.5 regulates cardiac excitability, yet the phosphorylation sites regulating its function and the underlying mechanisms remain largely unknown. Using a systematic, quantitative phosphoproteomic approach, we analyzed NaV1.5 channel complexes purified from nonfailing and failing mouse left ventricles, and we identified 42 phosphorylation sites on NaV1.5. Most sites are clustered, and three of these clusters are highly phosphorylated. Analyses of phosphosilent and phosphomimetic NaV1.5 mutants revealed the roles of three phosphosites in regulating NaV1.5 channel expression and gating. The phosphorylated serines S664 and S667 regulate the voltage dependence of channel activation in a cumulative manner, whereas the nearby S671, the phosphorylation of which is increased in failing hearts, regulates cell surface NaV1.5 expression and peak Na+ current. No additional roles could be assigned to the other clusters of phosphosites. Taken together, our results demonstrate that ventricular NaV1.5 is highly phosphorylated and that the phosphorylation-dependent regulation of NaV1.5 channels is highly complex, site specific, and dynamic.
Introduction
Voltage-gated Na+ (NaV) channels are key determinants of myocardial excitability, and defects in NaV channel expression or functioning in the context of inherited or acquired cardiac disease increase the propensity to develop lethal arrhythmias (Remme and Bezzina, 2010). Ventricular NaV channels, composed primarily of the NaV1.5 channel pore-forming subunit, in association with several accessory/regulatory proteins, generate the transient peak Na+ current (INa) responsible for the action potential upstroke and rapid intercellular conduction. While cardiac myocyte NaV channels inactivate quickly, there is a finite probability (∼0.5%) of channels remaining open, resulting in the late component of the Na+ current (INaL), which contributes to determining action potential duration. In the ventricular myocardium, the NaV1.5 protein is subject to many post-translational modifications, each of which fine-tunes channel expression and functioning in various physiological and disease contexts. Among the 11 different post-translational modifications previously shown to regulate cardiac NaV1.5 channels, phosphorylation at serine, threonine, and tyrosine residues is certainly the best characterized (reviewed in Marionneau and Abriel, 2015; Pei et al., 2016; Yu et al., 2018; Plant et al., 2020).
A role for phosphorylation in regulating cardiac NaV1.5 channels was first suggested in a pioneering study demonstrating that β-adrenergic receptors couple to NaV channels not only through a direct G protein pathway but also through an indirect PKA-dependent pathway (Schubert et al., 1989). The involvement of several additional kinases and phosphatases in regulating INa and/or INaL later spotlighted the functional relevance of cardiac NaV1.5 channel phosphorylation. Perhaps most strikingly, progress in mass spectrometry (MS)-based phosphoproteomic analyses recently buttressed the field by revealing the existence of multiple phosphorylation sites on native ventricular (Marionneau et al., 2012b; Burel et al., 2017) and heterologously expressed (Herren et al., 2015) NaV1.5 channels. Yet, little is known about the roles and detailed molecular mechanisms that underlie phosphorylation-dependent regulation of cardiac NaV1.5 channels.
Phosphorylation of NaV1.5 channels has also recently been suggested as an arrhythmogenic mechanism in heart failure (Wagner et al., 2006; Maltsev et al., 2008; Koval et al., 2012; Aiba et al., 2013; Toischer et al., 2013; Glynn et al., 2015). The NaV channel defects associated with heart failure are most often characterized by increased INaL and/or decreased INa, contributing to action potential prolongation and conduction slowing, respectively (Zicha et al., 2004; Valdivia et al., 2005; Maltsev et al., 2007; Xi et al., 2009; Aiba et al., 2013; Toischer et al., 2013). The increase in INaL has reportedly been linked to the activation of kinases, mainly the Ca2+/calmodulin-dependent protein kinase II (CaMKII; Wagner et al., 2006; Maltsev et al., 2008; Aiba et al., 2013; Toischer et al., 2013), and several studies have focused on identifying the CaMKII-dependent NaV1.5 phosphorylation sites (Hund et al., 2010; Ashpole et al., 2012; Herren et al., 2015; Burel et al., 2017). Notably, increased CaMKII-dependent NaV1.5 phosphorylation at serine 571 has been reported and suggested to increase INaL in nonischemic human heart failure (Koval et al., 2012) and in animal models of heart disease (Koval et al., 2012; Toischer et al., 2013; Glynn et al., 2015). Nevertheless, NaV1.5 channel phosphorylation may not be the sole mechanism involved in the observed pathophysiological defects, as other evidence suggests roles for up-regulation of the neuronal NaV1.1 (Xi et al., 2009; Mishra et al., 2015), NaV1.6 (Xi et al., 2009), or NaV1.8 (Dybkova et al., 2018) channels. Intensive investigations were also undertaken to understand the causes of the reduced INa; yet, the detailed underlying molecular mechanisms remain unclear. While most studies failed to detect any changes in NaV1.5 transcript or total protein expression in failing human hearts (Kääb et al., 1998) or in animal models of heart failure (Zicha et al., 2004; Valdivia et al., 2005), several mechanisms have been suggested to contribute to reduced INa, including the generation of a C-terminal truncation splicing variant switch in NaV1.5 transcripts (Shang et al., 2007; Noyes et al., 2017), elevated NADH and reactive oxygen species production (Liu et al., 2013), or increased intracellular Ca2+ concentration and subsequent increased expression of the E3 ubiquitin ligase Nedd4-2 (Luo et al., 2017). In line with reduced INa, a recent study using high-resolution imaging and functional techniques showed a reduction in NaV1.5 cluster size and a corresponding decreased number of open channels at the lateral membranes of ventricular myocytes from mice subjected to transverse aortic constriction (TAC), without any changes in NaV1.5 transcript or total protein expression (Rivaud et al., 2017).
In this study, we investigated the patterns of phosphorylation of native mouse left ventricular NaV1.5 channels and the roles of identified phosphorylation sites in regulating NaV1.5 channel expression and functioning. Using quantitative MS-based phosphoproteomic analyses, we identified and quantified in situ the native phosphorylation sites of the NaV1.5 in a mouse model of pressure overload–induced heart failure produced by TAC. By analyzing the expression and the functional properties of phosphosilent and phosphomimetic NaV1.5 mutant channels in human embryonic kidney 293 (HEK-293) cells, as well as simulating the consequences of phosphorylation on NaV1.5 peptide segment expansion, we identified phosphorylation hot spots for regulation of both channel cell surface expression and gating.
Materials and methods
Statement on the use of murine tissue
All investigations conformed to Directive 2010/63/EU of the European Parliament, to the Guide for the Care and Use of Laboratory Animals published by the National Institutes of Health (Publication No. 85-23, revised 1985), and to local institutional guidelines.
Animal model of heart failure
Heart failure was induced by TAC as described previously (Toischer et al., 2013). 8-wk-old male C57BL/6J mice were anesthetized using intraperitoneal injections of medetomidine (0.5 mg/kg), midazolam (5 mg/kg), and fentanyl (0.05 mg/kg body weight). A horizontal incision (1–1.5 cm) at the jugulum was used to display the transverse aorta, and a 27-gauge needle was tied against the aorta using a 6-0 nonabsorbable suture. After removal of the 27-gauge needle, the skin was closed, and the mice were kept on a heating plate until they recovered from the anesthesia. Sham animals underwent the same procedure except for the banding of the transverse aorta. At the end of the surgery, anesthesia was antagonized using intraperitoneal injections of atipamezole (2.5 mg/kg), flumazenil (0.5 mg/kg), and buprenorphine (0.1 mg/kg body weight). For analgesia, metamizole (1.33 mg/ml) was added to the drinking water 2 d before surgery and was supplied for 7 d after operation. In addition, buprenorphine (60 µg/kg body weight) was administered subcutaneously 1 h before surgery. A TAC with a mean gradient of <5 mm Hg was deemed insufficient to induce heart failure, and if observed, the animal was excluded from later analysis. Mice were sacrificed 5 wk after TAC by cervical dislocation, and left ventricles were harvested, flash frozen, and stored for further analyses.
Mouse echocardiography
Transthoracic echocardiography was performed blinded before and 5 wk after TAC using a Vevo 3100 system (VisualSonics) equipped with a 30-MHz center frequency transducer, as described previously (Toischer et al., 2013). The animals were initially anesthetized with 3% isoflurane, while temperature-, respiration-, and electrocardiogram-controlled anesthesia was maintained with 1.5% isoflurane. 2-D cine loops with frame rates of >200 frames/s of a long-axis view and a short-axis view at the midlevel of the papillary muscles, as well as M-mode loops of the short-axis view, were recorded. Thicknesses of the anterior and posterior walls of the left ventricle, the inner diameter of the left ventricle (LVID), and the area of the left ventricular cavity were measured in systole and diastole from the short-axis view according to standard procedures (Gao et al., 2011). Maximal left ventricular length was measured from the long-axis view. Systolic and diastolic left ventricular volumes were calculated using the area-length method, and the ejection fraction was derived. Left ventricular mass (LVM) was calculated from anterior and posterior wall thicknesses using Vevo LAB Software (VisualSonics). Pulsed-wave Doppler ultrasound was used to assess mean gradients 3 d after the TAC procedure.
Immunoprecipitation (IP) of NaV channel complexes
Flash-frozen left ventricles from four sham and five TAC mice were homogenized individually in ice-cold lysis buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, 0.5% amidosulfobetaine, 1× complete protease inhibitor cocktail tablet, 1 mM PMSF, 0.7 µg/ml pepstatin A (Thermo Fisher Scientific), and 1× Halt phosphatase inhibitor cocktail (Thermo Fisher Scientific) as described previously (Marionneau et al., 2012b). All reagents were from Sigma-Aldrich unless otherwise noted. After 15-min rotation at 4°C, 8 mg of the soluble protein fractions were precleared with 200 µl of protein G-magnetic Dynabeads (Thermo Fisher Scientific) for 1 h and subsequently used for IPs with 48 µg of an anti-NaVPAN mouse mAb (mαNaVPAN, S8809; Sigma-Aldrich) raised against the SP19 epitope (Vassilev et al., 1988) located in the third intracellular linker loop and common to all NaV channel pore-forming subunits. Prior to the IP, antibodies were cross-linked to 200 µl of protein G-magnetic Dynabeads using 20 mM dimethyl pimelimidate (Thermo Fisher Scientific; Schneider et al., 1982). Protein samples and antibody-coupled beads were mixed for 2 h at 4°C. Magnetic beads were then collected and washed rapidly four times with ice-cold lysis buffer, and isolated protein complexes were eluted from the beads in 1× SDS sample buffer (Bio-Rad Laboratories) at 60°C for 10 min. 99% of the immunoprecipitated mouse left ventricular NaV channel protein complexes were analyzed by MS, and the remaining 1% were used to verify IP yields by Western blotting using a rabbit polyclonal anti-NaV1.5 antibody (RbαNaV1.5, 1:1,000, ASC-005; Alomone Laboratories).
Peptide preparation and isobaric labeling for liquid chromatography (LC)-MS
The IP eluates were thawed on ice, reduced, and denatured by heating for 10 min at 95°C. The Cys residues were alkylated with iodoacetamide (10 mM) for 45 min at room temperature in the dark. The peptides were prepared using a modification (Erde et al., 2014) of the filter-aided sample preparation method (Wiśniewski et al., 2009). After the addition of 300 µl of 100 mM Tris buffer (pH 8.5) containing 8 M urea (UT buffer) and vortexing, the samples were transferred to YM-30 filter units (MRCF0R030; EMD Millipore) and spun for 14 min at 10,000 rcf (model 5424; Eppendorf). The filters were washed with 200 µl of UT buffer, and the spin-wash cycle was repeated twice. The samples were then exchanged into digest buffer with the addition of 200 µl of 50 mM Tris buffer, pH 8.0, followed by centrifugation (10,000 rcf for 10 min). After transferring the upper filter units to new collection tubes, 80 µl of digest buffer were added, and the samples were digested with trypsin (1 µg) for 4 h at 37°C. The digestion was continued overnight after adding another aliquot of trypsin. The filter units were then spun for 10 min (10,000 rcf) in an Eppendorf microcentrifuge. The filter was washed with 50 µl of Tris buffer (100 mM, pH 8.0), followed by centrifugation. The digests were extracted three times with 1 ml ethyl acetate and acidified to 1% trifluoroacetic acid (TFA) using a 50% aqueous solution. The pH was <2.0 by checking with pH paper. The solid-phase extraction of the peptides was performed using porous graphite carbon microtips (Chen et al., 2012). The peptides were eluted with 60% acetonitrile in 0.1% TFA and pooled for drying in a Speed-Vac (model Savant DNA 120 concentrator; Thermo Fisher Scientific) after adding TFA to 5%. The peptides were dissolved in 20 µl of 1% acetonitrile in water. An aliquot (10%) was removed for quantification using the Pierce Quantitative Fluorometric Peptide Assay Kit (23290; Thermo Fisher Scientific). The remainder of the peptides from each IP sample (∼0.5–3.5 µg) and 1.16 µg of reference pool peptide were transferred into a new 0.5-ml Eppendorf tube, dried in the Speed-Vac, and dissolved in 12 µl HEPES buffer (100 mM, pH 8.0, H3537; Sigma-Aldrich).
The samples were labeled with tandem mass tag (TMT) reagents (TMT11; Thermo Fisher Scientific) according to the manufacturer’s protocol. The labeled samples were pooled, dried, and resuspended in 120 µl of 1% formic acid (FA). The TMT11-labeled sample was desalted as described above for the unlabeled peptides. The eluates were transferred to autosampler vials (200046; SUN-SRi), dried, and stored at −80°C for capillary LC interfaced to a mass spectrometer (nanoscale LC-MS).
Nanoscale LC-MS
The samples in FA (1%) were loaded (2.5 µl) onto a 75-µm ID × 50-cm Acclaim PepMap 100 C18 RSLC column (Thermo Fisher Scientific) on an EASY nano-LC (Thermo Fisher Scientific). The column was equilibrated using constant pressure (700 bar) with 20 µl of solvent A (0.1% FA). The peptides were eluted using the following gradient program with a flow rate of 300 nl/min and using solvents A and B (acetonitrile with 0.1% FA): solvent A containing 5% B for 1 min, increased to 25% B over 87 min, to 35% B over 40 min, to 70% B in 6 min and constant 70% B for 6 min, to 95% B over 2 min and constant 95% B for 18 min. The data were acquired in data-dependent acquisition mode. The mass spectrum of peptide precursors (MS1) scans were acquired with the Orbitrap mass analyzer over mass-to-charge ratio = 375–1,500 and with resolution set to 70,000. 12 data-dependent high-energy collisional dissociation spectra (MS2) were acquired from each MS1 scan with a mass resolving power set to 35,000, a range of mass-to-charge ratio = 100–1,500, an isolation width of 2 Th, and a normalized collision energy setting of 32%. The maximum injection time was 60 ms for parent ion analysis and 120 ms for product ion analysis. The ions that were selected for MS2 were dynamically excluded for 20 s. The automatic gain control was set at a target value of 3e6 ions for MS1 scans and 1e5 ions for MS2. Peptide ions with charge states of 1 or ≥7 were excluded for higher-energy collision–induced dissociation acquisition.
MS data analysis
Peptide identification from raw MS data was performed using PEAKS Studio 8.5 (Bioinformatics Solutions Inc.; Zhang et al., 2012). The Uni-mouse-Reference-20131008 protein database was used for spectral matching. The precursor and product ion mass tolerances were set to 20 ppm and 0.05 D, respectively, and the enzyme cleavage specificity was set to trypsin, with a maximum of three missed cleavages allowed. Carbamidomethylation (Cys) and TMTs (Lys and/or peptide N terminus) were treated as fixed modifications, while oxidation (Met), pyroglutamination (Gln), deamidation (Asn and/or Gln), methylation (Lys and/or Arg), dimethylation (Lys and/or Arg), acetylation (Lys), and phosphorylation (Ser, Thr, and/or Tyr) were considered variable modifications. The definitive annotation of each NaV1.5 phosphopeptide–spectrum match was obtained by manual verification and interpretation. The phosphorylation site assignments were based on the presence or absence of the unphosphorylated and phosphorylated b and y ions flanking the site(s) of phosphorylation, ions referred to as “site-discriminating ions” throughout this study. When site-discriminating ions were not all detected, the assignment of phosphorylation sites was narrowed down to several possibilities by elimination (for example, pS1056 and/or pT1058). Representative MS/MS spectra, PEAKS −10lgP scores, mass errors of parent ions (in ppm), and charge state confirmations of site-discriminating b and y ions are presented in Table 2, Table S3, and Data S1.
The protein and peptide relative abundances in TAC versus sham mαNaVPAN-IPs were calculated using quantification of TMT reporter ions. Reporter ion intensities in each TMT channel were normalized to the mean reporter ion intensities of NaV1.5-derived peptides (normalization to spike) to correct for differences in IP yields and technical variabilities. Normalization factors are presented in Fig. S1 B. Quantification values of each peptide–spectrum match were exported into Excel, and the mean peptide abundance ratios were calculated from the abundance ratios of all manually verified peptide–spectrum matches assigning to the phosphorylation site(s) of interest. Label-free quantitative analysis of the areas of extracted MS1 chromatograms of phosphorylated and nonphosphorylated peptide ions covering the phosphorylation site(s) of interest was used to evaluate the proportion of phosphorylated to nonphosphorylated peptides at each position, as well as the relative abundances of phosphopeptides.
IP yields and relative quantification of NaV1.5 peptide abundances from sham and TAC mouse left ventricles (LVs). (A) Representative Western blots of total lysates and mαNaVPAN-IPs from sham and TAC LVs probed with the anti-NaV1.5 rabbit polyclonal (RbαNaV1.5) and anti-GAPDH mouse mAbs. (B) Normalization factors used in MS1 and MS2 analyses to correct for technical variabilities in NaV1.5 protein abundance in mαNaVPAN-IPs from sham and TAC LVs. (C) Distribution of TAC/sham log2-normalized ratios of NaV1.5 peptide spectrum matches. Both biochemical (A) and MS (B and C) analyses of NaV1.5 IP yields and peptide relative abundance demonstrate low technical variability.
IP yields and relative quantification of NaV1.5 peptide abundances from sham and TAC mouse left ventricles (LVs). (A) Representative Western blots of total lysates and mαNaVPAN-IPs from sham and TAC LVs probed with the anti-NaV1.5 rabbit polyclonal (RbαNaV1.5) and anti-GAPDH mouse mAbs. (B) Normalization factors used in MS1 and MS2 analyses to correct for technical variabilities in NaV1.5 protein abundance in mαNaVPAN-IPs from sham and TAC LVs. (C) Distribution of TAC/sham log2-normalized ratios of NaV1.5 peptide spectrum matches. Both biochemical (A) and MS (B and C) analyses of NaV1.5 IP yields and peptide relative abundance demonstrate low technical variability.
Plasmids
The NaV1.5 phosphomutant constructs were generated by mutating the serine(s)/threonine(s) to alanine(s) (A) or glutamate (E), as well as aspartate(s) (D) in the NaV1.5-S664-671D quadruple phosphomimetic channel, by site-directed mutagenesis of a pCI-NaV1.5 plasmid containing the human NaV1.5 hH1C cDNA (Makielski et al., 2003; National Center for Biotechnology Information reference sequence NM_000335) using the QuikChange II XL Site-Directed Mutagenesis Kit (Agilent) or the Q5 Site-Directed Mutagenesis Kit (New England Biolabs). The mutated constructs were then digested with restriction endonucleases to excise the mutated fragments, which were then subcloned into the original pCI-NaV1.5 plasmid. The human NaVβ1 (NM_001037; a gift from A.L. George, Department of Pharmacology, Northwestern University, Evanston, IL) cDNAs were subcloned into pRc/cytomegalovirus. All constructs were sequenced to ensure that no unintentional mutations were introduced.
Culture and transient transfections
HEK-293 cells were maintained in Dulbecco’s modified Eagle’s medium (Thermo Fisher Scientific), supplemented with 10% FBS, 100 U/ml penicillin, and 100 µg/ml streptomycin in a 37°C, 5% CO2, 95% air incubator. Cells were transiently transfected at 70–80% confluence in 35-mm dishes with 0.6 µg of the WT or phosphomutant NaV1.5 plasmid and 1.2 µg of the NaVβ1 plasmid using 2 µl Lipofectamine 2000 (Thermo Fisher Scientific) following the manufacturer’s instructions. For whole-cell recordings, transfections also contained 0.2 µg of the pEGFP plasmid (enhanced GFP plasmid; Clontech), and EGFP expression served as a marker of transfection. The absolute amounts of the various constructs were calculated, and the empty pcDNA3.1 plasmid was used as a filler plasmid to keep the total DNA constant at 2 µg in each transfection.
Electrophysiological recordings
Whole-cell NaV currents were recorded at room temperature from transiently transfected HEK-293 cells using an Axopatch 200A amplifier (Axon Instruments/Molecular Devices) 48 h after transfection. Voltage-clamp protocols were applied using the pClamp 10.2 software package (Axon Instruments) interfaced to the electrophysiological equipment using a Digidata 1440A digitizer (Axon Instruments). Current signals were filtered at 10 kHz before digitization at 50 kHz and storage. Patch-clamp pipettes were fabricated from borosilicate glass (OD, 1.5 mm; ID, 0.86 mm; Sutter Instrument) using a P-97 micropipette puller (Sutter Instrument), coated with wax, and fire polished to a resistance between 1.5 and 2.5 MΩ when filled with internal solution. The internal solution contained (in mM) 5 NaCl, 115 CsF, 20 CsCl, 10 HEPES, and 10 EGTA (pH 7.35 with CsOH, ∼300 mosM). The external solution contained (in mM) 10 NaCl (20 NaCl for analysis of single phosphomutants), 103 CsCl, 25 TEA-Cl, 10 HEPES, 5 glucose, 1 CaCl2, and 2 MgCl2 (pH 7.4 with CsOH, ∼300 mosM). All chemicals were purchased from Sigma-Aldrich. After establishing the whole-cell configuration, 3 min were allowed to ensure stabilization of voltage-dependence of activation and inactivation properties, at which time 25-ms voltage steps to ±10 mV from a holding potential (HP) of −70 mV were applied to allow measurement of whole-cell Cm, input, and series resistances. Only cells with access resistance <7 MΩ were used, and input resistances were typically >5 GΩ. After compensation of series resistance (80%), the membrane was held at an HP of −120 mV, and the voltage-clamp protocols were performed as indicated below. Leak currents were always <200 pA at HP (−120 mV) and were corrected offline. Cells exhibiting peak current amplitudes <500 or >5,000 pA were excluded from analyses of biophysical properties because of leak or voltage-clamp issues, respectively, but were conserved in analyses of peak current density to avoid bias in evaluation of current densities.
Data were compiled and analyzed using ClampFit 10.2 (Axon Instruments), Microsoft Excel, and Prism (GraphPad Software). Whole-cell Cm values were determined by analyzing the decays of capacitive transients elicited by brief (25-ms) voltage steps to ±10 mV from the HP (−70 mV). Input resistances were calculated from the steady-state currents elicited by the same ±10-mV steps (from the HP). Series resistances were calculated by dividing the decay time constants of the capacitive transients (fitted with single exponentials) by the Cm. To determine peak Na+ I-V relationships, currents were elicited by 50-ms depolarizing pulses to potentials ranging from −80 to +40 mV (presented at 5-s intervals in 5-mV increments) from an HP of −120 mV. Peak current amplitudes were defined as the maximal currents evoked at each voltage. Current amplitudes were leak corrected and normalized to the Cm, and current densities are presented.
To analyze voltage dependence of current activation properties, G values were calculated, and G-V relationships were fitted with the Boltzmann equation G = Gmax/{1 + exp[−(Vm − V1/2) / k]}, in which V1/2 is the membrane potential of half-activation and k is the slope factor. The time courses of inactivation of macroscopic currents were fitted with biexponential functions, I(t) = Afast × exp(−t/τfast) + Aslow × exp(−t/τslow) + A0, in which Afast and Aslow are the amplitudes of the fast and slow inactivating current components, respectively, and τfast and τslow are the decay time constants of Afast and Aslow, respectively. A standard two-pulse protocol was used to examine the voltage dependences of steady-state inactivation. From an HP of −120 mV, 1-s conditioning pulses to potentials ranging from −120 to −45 mV (in 5-mV increments) were followed by 20-ms test depolarizations to −20 mV (interpulse intervals were 5 s). Current amplitudes evoked from each conditioning voltage were measured and normalized to the maximal current (Imax) evoked from −120 mV, and normalized currents were plotted as a function of the conditioning voltage. The resulting steady-state inactivation curves were fitted with the Boltzmann equation I = Imax/{1 + exp[(Vm − V1/2) / k)]}, in which V1/2 is the membrane potential of half-inactivation and k is the slope factor. To examine the rates of recovery from inactivation, a three-pulse protocol was used. Cells were first depolarized to −20 mV (from an HP of −120 mV) to inactivate the channels and subsequently repolarized to −120 mV for varying times (ranging from 1 to 200 ms), followed by test depolarizations to −20 mV to assess the extent of recovery (interpulse intervals were 5-s). The current amplitudes at −20 mV, measured following each recovery period, were normalized to the maximal current amplitude and plotted as a function of the recovery time. The resulting plot was fitted with a single exponential function I(t) = A × [1 − exp(−t/τrec)] to determine the recovery time constant. For each of these biophysical properties, data from individual cells were first fitted and then averaged.
The currents generated on expression of each phosphosilent and phosphomimetic NaV1.5 mutant were recorded and compared with currents generated by the NaV1.5-WT construct obtained on the same days of patch-clamp analyses. The densities and properties of NaV1.5-WT currents in each dataset were similar, and, for the sake of clarity, a single representative NaV1.5-WT channel dataset was chosen and presented in Fig. S3 and Tables 3 and 4.
In experiments aimed at recording the tetrodotoxin (TTX)-sensitive INaL, cells were bathed in external solution containing (in mM) 120 NaCl, 25 TEA-Cl, 10 HEPES, 5 glucose, 1 CaCl2, and 2 MgCl2 (pH 7.4 with CsOH, ∼300 mosM). Repetitive 350-ms test pulses to −20 mV from an HP of −120 mV (at 5-s intervals) were applied to cells to record INa in the absence of TTX. Cells were then superfused locally with the external solution supplemented with 30 µM TTX (Bio-Techne SAS). Only cells exhibiting peak current amplitudes >4,000 pA were used (those with peak currents <4,000 pA did not show measurable INaL), and cells with difference in leak current amplitudes before and after TTX application >5 pA at −20 mV (calculated from leak currents at −120 mV) were excluded from analyses. TTX-sensitive currents from individual cells were determined by offline digital subtraction of average leak-subtracted currents obtained from five recordings in the absence and in the presence of TTX after achieving steady state. The amplitude of TTX-sensitive INaL was defined as the steady-state current amplitude (A0) obtained by fitting the inactivation decay of macroscopic TTX-sensitive current with the double-exponential function I(t) = Afast × exp (−t/τfast) + Aslow × exp (−t/τslow) + A0. For each cell, the TTX-sensitive INaL amplitude was normalized to the peak INa amplitude and expressed as a percentage of the peak INa.
Cell surface biotinylation and Western blot analyses
Surface biotinylation of HEK-293 cells was completed as described previously (Marionneau et al., 2012a). Briefly, cells were incubated with the cleavable EZ-Link Sulfo-NHS-SS-Biotin (0.5 mg/ml; Thermo Fisher Scientific) in ice-cold PBS (pH 7.4) for 30 min at 4°C. Free biotin was quenched with Tris-saline (10 mM Tris [pH 7.4], 120 mM NaCl), and detergent-soluble cell lysates were prepared. Biotinylated cell surface proteins were affinity purified using NeutrAvidin-conjugated agarose beads (Thermo Fisher Scientific), and purified cell surface proteins were analyzed by Western blot using the mαNaVPAN antibody (1:2,000, S8809; Sigma-Aldrich), the anti–transferrin receptor mouse mAb (TransR, 1:1000, Thermo Fisher Scientific), and the anti-glyceraldehyde 3-phosphate dehydrogenase mouse mAb (anti-GAPDH, 1:100,000; Santa Cruz Biotechnology). Bound primary antibodies were detected using horseradish peroxidase–conjugated goat anti-mouse secondary antibodies (Cell Signaling Technology), and protein signals were visualized using the SuperSignal West Dura Extended Duration Substrate (Thermo Fisher Scientific). Bands corresponding to NaV1.5 were normalized to bands corresponding to TransR from the same sample. NaV1.5 phosphomutant protein expression (total or cell surface) is expressed relative to NaV1.5-WT protein expression (total or cell surface).
Molecular simulations
Molecular simulations were performed with the CAMPARI software package (Vitalis and Pappu, 2009b) using the ABSINTH implicit solvation model (Vitalis and Pappu, 2009a) and parameters from the all-atom optimized potentials for liquid simulations force field. Markov chain Metropolis Monte Carlo moves sampled the conformational space of each protein segment. To mimic a 5 mM NaCl concentration, neutralizing and excess Na+ and Cl− ions were modeled explicitly with the protein segments in spherical droplets of (5 × number of residues) Å radius. 10 simulation runs were performed for each sequence construct, and the average of these 10 runs was then plotted. The simulations denoted as EV (excluded volume) and FRC (Flory random coil) are reference models. In the EV limit, the only interactions considered are the pairwise repulsions. In the FRC limit, conformations are constructed by randomly sampling residue-specific backbone dihedral angles. Three EV and three FRC simulation runs were performed for each protein segment, and the averages were plotted.
Statistical analyses
Results are expressed as means ± SEMs. Data were first tested for normality using the D’Agostino and Pearson normality test. Depending on the results of normality tests, statistical analyses were then performed using the Mann-Whitney nonparametric test, Kruskal-Wallis one-way ANOVA followed by Dunn’s post-hoc test, or one-way ANOVA followed by Dunnett’s post-hoc test, as indicated in figures and tables. All these analyses, as well as plots and graphs, were performed using Prism software (GraphPad Software).
Online supplemental material
The supplemental figures and tables show multiple pieces of raw or analyzed data to complement the main figures as explicated in the text. Fig. S1 shows IP yields and relative quantification of NaV1.5 peptide abundances from sham and TAC mouse left ventricles. Fig. S2 shows conservation of phosphorylation sites in mouse and human NaV1.5. Fig. S3 shows distributions and mean ± SEM membrane potentials for half-activation and half-inactivation, peak INa densities, and time constants of recovery from inactivation of WT and mutant NaV1.5 channels. Fig. S4 shows distributions and mean ± SEM of TTX-sensitive INaL densities of quadruple S664-671 and simple S671 NaV1.5 phosphomutants. Data S1 shows representative MS/MS spectra corresponding to the phosphopeptides enabling the best phosphorylation site assignment(s) for each phosphorylation site. Table S1 lists echocardiographic parameters of sham and TAC mice before and 5 wk after surgery. Table S2 summarizes NaV1.5 phosphorylation sites identified in the present and previous studies. Table S3 lists phosphorylation sites, phosphopeptides, and site-discriminating ions identified in coimmunoprecipitated NaV α subunits from sham and TAC mouse left ventricles using MS.
Results
Purification and characterization of NaV channel complexes from sham and TAC mouse left ventricles
NaV channel complexes from four sham-operated and five TAC mouse left ventricles were purified by IP using an mαNaVPAN and characterized using quantitative isobaric TMT-based analysis. As illustrated in Table S1, and consistent with previous findings (Toischer et al., 2013), the echocardiographic analysis confirmed increased LVMs (LVM/body weight ratios), reduced ejection fractions, but unaltered left ventricular end-diastolic diameters (LVID;d) 5 wk after the TAC surgery, demonstrating left ventricular concentric hypertrophy and systolic contractile dysfunction or heart failure in the TAC animals. Western blot analyses of total lysates showed similar total NaV1.5 protein expression in sham and TAC left ventricles, which resulted in similar NaV1.5 IP yields in the nine samples (Fig. S1 A). Isolated NaV channel complexes were then digested with trypsin, and peptide mixtures were labeled with different TMTs and combined in the same TMT set for multiplexed MS/MS analysis (Fig. 1 E). As illustrated in Table 1, the NaV1.5 protein was the most represented protein in the mαNaVPAN-IPs, with 310 unique and NaV1.5-specific peptides identified and 56% amino acid sequence coverage (70% with the transmembrane domains removed; Fig. 2).
Localization and quantification of 42 MS-identified NaV1.5 phosphorylation sites in mαNaVPAN-IPs from sham and TAC mouse left ventricles (LVs). (A) Schematic representation of phosphorylation sites on the NaV1.5 protein (UniProt reference sequence K3W4N7). Two phosphorylation site locations are possible at amino acids S1056-T1058. (B) The areas of extracted MS1 ion chromatograms, corresponding to MS2 spectra assigning phosphorylated (in red) and nonphosphorylated (in white) NaV1.5 peptides at indicated phosphorylation site(s), in mαNaVPAN-IPs from sham and TAC LVs are indicated. No red color is visible for the phosphorylated peptide at position T1809, because this phosphopeptide area is very small (area = 80,291 arbitrary unit) relative to the areas of the nonphosphorylated peptides (areas = 80,060,220 arbitrary unit). (C) The areas of extracted MS1 ion chromatograms, corresponding to MS2 spectra assigning phosphorylated peptides at indicated phosphorylation site(s), in mαNaVPAN-IPs from sham and TAC LVs are indicated. The brackets indicate the subgroups of phosphorylation sites analyzed in B. Independent quantification of S459 and S460 phosphorylated peptides was not possible, because localization of the phosphorylation site in most of the phosphorylated peptides could not be discriminated. Similar to B, no red bar is visible for the phosphorylated peptide at position T1809, because this phosphopeptide area is very small (area = 80,291 arbitrary unit), relative to the areas of the other phosphorylated peptides. (D) Distributions and mean ± SEM relative abundances of individual NaV1.5 phosphopeptides allowing assignments of indicated phosphorylation site(s), as well as of corresponding nonphosphorylated (NP) peptides, in TAC LV (n = 5, in black) versus sham LV (n = 4, in white) mαNaVPAN-IPs were obtained using TMT reporter ion intensities. The relative abundances of NaV1.5 phosphopeptides exhibiting phosphorylation(s) on serine 671 (S671; n = 12 peptides) alone or in combination with serine 664 (S664 + S671; n = 9 peptides) or serine 667 (S667 + S671; n = 7 peptides) are increased (**, P < 0.01; ***, P < 0.001; Mann-Whitney test) in TAC LV versus sham LV mαNaVPAN-IPs. (E) Experimental workflow used in the study. Once immunoprecipitated using the mαNaVPAN antibodies, the NaV channel complexes from sham and TAC mouse LVs were labeled individually with different TMT10 tags and combined in the same TMT set for multiplexed LC-MS/MS analysis. NaV1.5 phosphorylation sites were identified, quantified, and analyzed by clusters in whole-cell voltage-clamp recordings in HEK-293 cells.
Localization and quantification of 42 MS-identified NaV1.5 phosphorylation sites in mαNaVPAN-IPs from sham and TAC mouse left ventricles (LVs). (A) Schematic representation of phosphorylation sites on the NaV1.5 protein (UniProt reference sequence K3W4N7). Two phosphorylation site locations are possible at amino acids S1056-T1058. (B) The areas of extracted MS1 ion chromatograms, corresponding to MS2 spectra assigning phosphorylated (in red) and nonphosphorylated (in white) NaV1.5 peptides at indicated phosphorylation site(s), in mαNaVPAN-IPs from sham and TAC LVs are indicated. No red color is visible for the phosphorylated peptide at position T1809, because this phosphopeptide area is very small (area = 80,291 arbitrary unit) relative to the areas of the nonphosphorylated peptides (areas = 80,060,220 arbitrary unit). (C) The areas of extracted MS1 ion chromatograms, corresponding to MS2 spectra assigning phosphorylated peptides at indicated phosphorylation site(s), in mαNaVPAN-IPs from sham and TAC LVs are indicated. The brackets indicate the subgroups of phosphorylation sites analyzed in B. Independent quantification of S459 and S460 phosphorylated peptides was not possible, because localization of the phosphorylation site in most of the phosphorylated peptides could not be discriminated. Similar to B, no red bar is visible for the phosphorylated peptide at position T1809, because this phosphopeptide area is very small (area = 80,291 arbitrary unit), relative to the areas of the other phosphorylated peptides. (D) Distributions and mean ± SEM relative abundances of individual NaV1.5 phosphopeptides allowing assignments of indicated phosphorylation site(s), as well as of corresponding nonphosphorylated (NP) peptides, in TAC LV (n = 5, in black) versus sham LV (n = 4, in white) mαNaVPAN-IPs were obtained using TMT reporter ion intensities. The relative abundances of NaV1.5 phosphopeptides exhibiting phosphorylation(s) on serine 671 (S671; n = 12 peptides) alone or in combination with serine 664 (S664 + S671; n = 9 peptides) or serine 667 (S667 + S671; n = 7 peptides) are increased (**, P < 0.01; ***, P < 0.001; Mann-Whitney test) in TAC LV versus sham LV mαNaVPAN-IPs. (E) Experimental workflow used in the study. Once immunoprecipitated using the mαNaVPAN antibodies, the NaV channel complexes from sham and TAC mouse LVs were labeled individually with different TMT10 tags and combined in the same TMT set for multiplexed LC-MS/MS analysis. NaV1.5 phosphorylation sites were identified, quantified, and analyzed by clusters in whole-cell voltage-clamp recordings in HEK-293 cells.
Proteins identified in immunoprecipitated NaV channel complexes from sham and TAC mouse left ventricles using MS
| Protein | UniProt accession number | No. of exclusive unique peptides | Percentage amino acid sequence coverage | TAC/sham ratio | Protein | UniProt accession number | No. of exclusive unique peptides | Percentage amino acid sequence coverage | TAC/sham ratio |
|---|---|---|---|---|---|---|---|---|---|
| NaV1.5 (Q1080) | K3W4N7 | 310 | 56% | 1.0 | N-cadherin | P15116 | 13 | 24% | 0.8 |
| NaV1.5 (Q1080del) | Q9JJV9 | ||||||||
| NaV1.4 | G3X8T7 | 86 | 40% | 0.8 | Plakophilin-2 | Q9CQ73 | 13 | 20% | 0.7 |
| NaV1.3 | A2ASI5 | 24 | 17% | 0.9 | Plakophilin-1 | P97350 | 5 | 8% | 0.8 |
| NaV1.8 | Q6QIY3 | 13 | 9% | 0.9 | Telethonin | O70548 | 5 | 44% | 0.8 |
| NaV1.7 | Q62205 | 3 | 2% | 0.7 | Desmoglein-2 | O55111 | 13 | 19% | 0.7 |
| NaV1.9 | Q9R053 | 1 | 1% | 1.2 | Flotillin-1 | O08917 | 22 | 59% | 0.9 |
| NaV1.1 | A2APX8 | 1 | 0.5% | 1.3 | Flotillin-2 | Q60634 | 21 | 54% | 0.8 |
| NaV1.2 | B1AWN6 | 1 | 0.5% | 1.2 | 14-3-3 zeta/delta | P63101 | 5 | 27% | 0.9 |
| NaV1.6 | F6U329 | 1 | 0.6% | 1.0 | 14-3-3 epsilon | P62259 | 3 | 17% | 1.0 |
| NaVβ4 | Q7M729 | 11 | 44% | 0.7 | 14-3-3 gamma | P61982 | 3 | 14% | 1.0 |
| NaVβ1 | P97952 | 9 | 41% | 1.0 | 14-3-3 beta/alpha | Q9CQV8 | 1 | 6% | 1.1 |
| NaVβ2 | Q56A07 | 6 | 37% | 0.8 | 14-3-3 sigma | O70456 | 1 | 3% | 0.9 |
| Calmodulin | Q3UKW2 | 12 | 53% | 0.8 | Slmap | Q3URD3 | 1 | 1% | 1.1 |
| FHF2-VY | P70377 | 37 | 84% | 0.8 | αB-Crystallin | P23927 | 14 | 71% | 0.7 |
| FHF4 | P70379 | 1 | 7% | 0.7 | Cx43 | P23242 | 15 | 50% | 0.7 |
| Ankyrin-G | G5E8K5 | 47 | 32% | 1.0 | Kir2.1 | P35561 | 3 | 11% | 0.8 |
| Ankyrin-R | Q02357 | 2 | 2% | 1.0 | CaMKIIγ | Q923T9 | 11 | 26% | 0.8 |
| Ankyrin-B | S4R245 | 1 | 0.4% | 0.8 | CaMKIIδ | E9Q1T1 | 2 | 6% | 1.1 |
| Dystrophin | P11531 | 88 | 29% | 0.9 | CaMKIIα | P11798 | 2 | 4% | 0.8 |
| α1-Syntrophin | A2AKD7 | 20 | 53% | 0.8 | CaMKIIβ | Q5SVI2 | 1 | 3% | 0.9 |
| β2-Syntrophin | Q61235 | 19 | 35% | 0.9 | PKA, catalytic subunit, α | P05132 | 2 | 9% | 1.0 |
| α-Actinin-2 | Q9JI91 | 50 | 60% | 0.5 | PKAβ-2 | Q6PAM0 | 1 | 4% | 1.1 |
| Caveolin-1 | P49817 | 6 | 39% | 0.8 | PKCβ | P68404 | 2 | 3% | 1.6 |
| Caveolin-2 | Q9WVC3 | 3 | 28% | 0.9 | Fyn | P39688 | 1 | 2% | 1.1 |
| Caveolin-3 | P51637 | 2 | 11% | 0.8 | PP2A-C | P63330 | 1 | 3% | 1.1 |
| Vinculin | Q64727 | 25 | 29% | 0.7 |
| Protein | UniProt accession number | No. of exclusive unique peptides | Percentage amino acid sequence coverage | TAC/sham ratio | Protein | UniProt accession number | No. of exclusive unique peptides | Percentage amino acid sequence coverage | TAC/sham ratio |
|---|---|---|---|---|---|---|---|---|---|
| NaV1.5 (Q1080) | 310 | 56% | 1.0 | N-cadherin | 13 | 24% | 0.8 | ||
| NaV1.5 (Q1080del) | |||||||||
| NaV1.4 | 86 | 40% | 0.8 | Plakophilin-2 | 13 | 20% | 0.7 | ||
| NaV1.3 | 24 | 17% | 0.9 | Plakophilin-1 | 5 | 8% | 0.8 | ||
| NaV1.8 | 13 | 9% | 0.9 | Telethonin | 5 | 44% | 0.8 | ||
| NaV1.7 | 3 | 2% | 0.7 | Desmoglein-2 | 13 | 19% | 0.7 | ||
| NaV1.9 | 1 | 1% | 1.2 | Flotillin-1 | 22 | 59% | 0.9 | ||
| NaV1.1 | 1 | 0.5% | 1.3 | Flotillin-2 | 21 | 54% | 0.8 | ||
| NaV1.2 | 1 | 0.5% | 1.2 | 14-3-3 zeta/delta | 5 | 27% | 0.9 | ||
| NaV1.6 | 1 | 0.6% | 1.0 | 14-3-3 epsilon | 3 | 17% | 1.0 | ||
| NaVβ4 | 11 | 44% | 0.7 | 14-3-3 gamma | 3 | 14% | 1.0 | ||
| NaVβ1 | 9 | 41% | 1.0 | 14-3-3 beta/alpha | 1 | 6% | 1.1 | ||
| NaVβ2 | 6 | 37% | 0.8 | 14-3-3 sigma | 1 | 3% | 0.9 | ||
| Calmodulin | 12 | 53% | 0.8 | Slmap | 1 | 1% | 1.1 | ||
| FHF2-VY | 37 | 84% | 0.8 | αB-Crystallin | 14 | 71% | 0.7 | ||
| FHF4 | 1 | 7% | 0.7 | Cx43 | 15 | 50% | 0.7 | ||
| Ankyrin-G | 47 | 32% | 1.0 | Kir2.1 | 3 | 11% | 0.8 | ||
| Ankyrin-R | 2 | 2% | 1.0 | CaMKIIγ | 11 | 26% | 0.8 | ||
| Ankyrin-B | 1 | 0.4% | 0.8 | CaMKIIδ | 2 | 6% | 1.1 | ||
| Dystrophin | 88 | 29% | 0.9 | CaMKIIα | 2 | 4% | 0.8 | ||
| α1-Syntrophin | 20 | 53% | 0.8 | CaMKIIβ | 1 | 3% | 0.9 | ||
| β2-Syntrophin | 19 | 35% | 0.9 | PKA, catalytic subunit, α | 2 | 9% | 1.0 | ||
| α-Actinin-2 | 50 | 60% | 0.5 | PKAβ-2 | 1 | 4% | 1.1 | ||
| Caveolin-1 | 6 | 39% | 0.8 | PKCβ | 2 | 3% | 1.6 | ||
| Caveolin-2 | 3 | 28% | 0.9 | Fyn | 1 | 2% | 1.1 | ||
| Caveolin-3 | 2 | 11% | 0.8 | PP2A-C | 1 | 3% | 1.1 | ||
| Vinculin | 25 | 29% | 0.7 |
The numbers of exclusive unique peptides, the percentage amino acid sequence coverages, and the fold change abundance ratios in TAC left ventricle (n = 5) versus sham left ventricle (n = 4) mαNaVPAN-IPs for each identified protein are presented. No significant differences in protein abundance were observed between TAC and sham IPs. Cx, connexin; FHF, fibroblast growth factor homologous factor; Kir, inward rectifier K+ channel; PP2A-C, catalytic subunit of protein phosphatase 2A; Slmap, sarcolemmal membrane-associated protein.
NaV1.5 amino acid sequence coverage and localization of 42 NaV1.5 phosphorylation sites in mαNaVPAN-IPs from sham and TAC mouse left ventricles. Covered sequence and MS-identified phosphorylation sites are highlighted in yellow and red, respectively; transmembrane segments (S1-S6) in each domain (I–IV) are in bold and underlined in black; and loops I, II, and III correspond to interdomains I–II, II–III, and III–IV, respectively. The identification of peptides differing by the presence or absence of a glutamine (Q) at position 1080 ascertains the expression of two NaV1.5 variants: the Q1080 variant corresponds to UniProt reference sequence K3W4N7, and the Q1080del variant corresponds to UniProt reference sequence Q9JJV9. Two phosphorylation site locations are possible at amino acids S1056-T1058 (in green). C-TERM, C terminus; N-TERM, N terminus.
NaV1.5 amino acid sequence coverage and localization of 42 NaV1.5 phosphorylation sites in mαNaVPAN-IPs from sham and TAC mouse left ventricles. Covered sequence and MS-identified phosphorylation sites are highlighted in yellow and red, respectively; transmembrane segments (S1-S6) in each domain (I–IV) are in bold and underlined in black; and loops I, II, and III correspond to interdomains I–II, II–III, and III–IV, respectively. The identification of peptides differing by the presence or absence of a glutamine (Q) at position 1080 ascertains the expression of two NaV1.5 variants: the Q1080 variant corresponds to UniProt reference sequence K3W4N7, and the Q1080del variant corresponds to UniProt reference sequence Q9JJV9. Two phosphorylation site locations are possible at amino acids S1056-T1058 (in green). C-TERM, C terminus; N-TERM, N terminus.
Consistent with the homogeneous yields in the NaV1.5 IP, the relative abundance of the NaV1.5 peptides detected by MS in the nine samples was similar and used for normalization of each single protein and peptide abundance (Fig. S1 B). Accordingly, the distribution of normalized abundance ratios of NaV1.5 peptides (in log2) in TAC versus sham mαNaVPAN-IPs was centered on zero (Fig. S1 C). Altogether, therefore, these observations attest to a high reproducibility across biological replicates and a low technical variability inherent to experimental procedures. Of note, and as described previously (Makielski et al., 2003), several NaV1.5 peptides differing by the presence (1079-QQESQVVSGGHEPPQEPR, Q1080 variant) or absence (1077-SKQESQVVSGGHEPPQEPR and 1078-KQESQVVSGGHEPPQEPR, Q1080del variant) of a glutamine (Q) at position 1080 were detected (Table 1 and Fig. 2), reflecting the expression of two distinct NaV1.5 variants in adult mouse left ventricles; Q1080del corresponds to the commonly reported hH1C variant. The identification of additional, nondiscriminating peptides (1079-QESQVVSGGHEPPQEPR and 1079-QESQVVSGGH), which could arise from either variant, however, prevented us from quantifying the relative abundance of the two NaV1.5 variants. These analyses also allowed the identification of eight additional NaV channel pore-forming subunits, among which NaV1.4 is the most abundant, with 86 unique NaV1.4-specific peptides detected (Table 1). In addition, several previously identified NaV1.5 channel associated/regulatory proteins, including calmodulin, the VY variant of fibroblast growth factor homologous factor 2 (FHF2-VY) and ankyrin-G, were detected, with no significant differences in abundance between sham and TAC mαNaVPAN-IPs (Table 1).
Identification and quantification of 42 NaV1.5 phosphorylation sites in sham and TAC mouse left ventricles
The phosphoproteomic analysis of the mαNaVPAN-IPs from sham and TAC mouse left ventricles allowed the unambiguous identification of 42 native phosphorylation sites in the NaV1.5 protein, 19 of which have never, to our knowledge, been previously described (Figs. 1 A and 2). Table 2 lists the phosphopeptides enabling the best phosphorylation site assignment(s) for each phosphorylation site, and corresponding MS/MS spectra are presented in Data S1. Table S2 lists these 42 phosphorylation sites with all the other phosphorylation sites identified so far on the mouse and/or human NaV1.5 protein, whether by using MS, in silico, and/or in vitro analyses. Interestingly, the vast majority of these 42 phosphorylation sites are clustered, with the first intracellular linker loop of NaV1.5 revealed as a hot spot for phosphorylation, with a total of 21 sites identified. Further label-free quantitative analysis of the areas of extracted MS1 peptide ion chromatograms revealed large differences in the relative abundance of the individual phosphopeptides and the existence of three highly phosphorylated clusters at positions S457-S460, S483-T486, and S664-S671 (Fig. 1 B). In addition, and in contrast to the other phosphorylation sites, the phosphorylated peptides assigning these three phosphorylation clusters are more abundant than their nonphosphorylated counterparts, suggesting that these sites are mostly phosphorylated in native NaV1.5 channels in WT mouse left ventricles. Looking into the detailed quantification of single phosphorylation sites inside each of these clusters, however, major differences in phosphopeptide abundance are evident (Fig. 1 C). This is the case, for example, of phosphorylation at S664 or S667, which is ∼10-fold more abundant than at residues T670 or S671.
Phosphorylation sites, phosphopeptides, and site-discriminating ions identified in immunoprecipitated NaV1.5 proteins from sham and TAC mouse left ventricles using MS
| Phosphorylation site(s) | Phosphopeptide sequence | m/z (charge) | −10lgP score | b Ion | Phospho b ion | y Ion | Phospho y ion | TAC/sham ratio |
|---|---|---|---|---|---|---|---|---|
| S12 | 9-GTS(pS)FRR | 560.279 (+2) | 21.6 | b3 (+1) | (-) | y3 | (-) | 1.2 (n = 1) |
| S36 | 35-G(pS)ATSQESR | 616.279 (+2) | 32.1 | b1 | (-) | y7 | (-) | 1.3 (n = 1) |
| S42 | 35-GSATSQE(pS)REGLPEEEAPRPQLDLQASK | 887.947 (+4) | 73.1 | b7 (+1) | (-) | y19 (+2) | y21 (+2) | 1.5 ± 0.03 (n = 3) |
| S39 + S42 | 35-GSAT(pS)QE(pS)REGLPEEEAPRPQLDLQASK | 907.937 (+4) | 68.4 | b4 (+1) | (-) | y19 (+2) | y21 | 1.2 ± 0.12 (n = 2) |
| S457 (+ S459 or S460) | 452-GVDTV(pS)RSSLEMSPLAPVTNHER | 957.782 (+3) | 77.1 | b5 (+1) | b7 (−98) (+2) | y14 (+1) | (-) | 1.1 ± 0.09 (n = 10) |
| S459 + S460 | 452-GVDTVSR(pS)(pS)LEMSPLAPVTNHER | 958.117 (+3) | 41.5 | b7 (+2) | b11 (+2) | y12 (+1) | (-) | 1.2 (n = 1) |
| S460 | 459-S(pS)LEMSPLAPVTNHER | 1039.003 (+2) | 61.2 | b1 (+1) | b4 (+1) | y14 (+1) | (-) | 1.0 ± 0.05 (n = 18) |
| S483 | 481-RL(pS)SGTEDGGDDRLPK | 561.038 (+4) | 52.4 | b2 | b3 | y13 (+2) | (-) | 1.0 ± 0.03 (n = 10) |
| S484 | 482-LS(pS)GTEDGGDDR | 759.319 (+2) | 45.7 | b2 | (-) | y9 (+1) | (-) | 1.2 ± 0.07 (n = 12) |
| T486 | 484-SG(pT)EDGGDDRLPK | 628.973 (+3) | 21.9 | b1 | b5 | y8 (+2) | (-) | 1.2 (n = 1) |
| S483 + S484 | 480-KRL(pS)(pS)GTEDGGDDRLPK | 536.476 (+5) | 63 | b3 | (-) | y12 (+2) | (-) | 1.3 ± 0.04 (n = 19) |
| S497 | 482-LSSGTEDGGDDRLPK(pS)DSEDGPR | 732.845 (+4) | 60.2 | b12 (+2) | (-) | y7 (+1) | y12 | 1.3 ± 0.07 (n = 7) |
| S483 + S497 | 481-RL(pS)SGTEDGGDDRLPK(pS)DSEDGPR | 791.862 (+4) | 40.1 | b2 | b3 (−98) | y6 (+1) | y12 (+2) | 0.7 (n = 1) |
| S484 + S497 | 482-LS(pS)GTEDGGDDRLPK(pS)DSEDGPR | 1003.448 (+3) | 54.8 | b2 (+1) | b3 | y7 (+1) | y12 (+2) | 1.7 ± 0.04 (n = 2) |
| S499 | 497-SD(pS)EDGPR | 586.245 (+2) | 42 | b2 | b5 | y4 (+1) | y6 | 1.4 ± 0.17 (n = 3) |
| S510 | 505-ALNQL(pS)LTHGLSR | 573.643 (+3) | 51.8 | b4 (+1) | (-) | y7 (+1) | (-) | 0.9 ± 0.03 (n = 3) |
| S516 | 505-ALNQLSLTHGL(pS)R | 573.644 (+3) | 46.7 | b9 | (-) | y1 (+1) | (-) | 0.9 (n = 1) |
| S525 | 524-S(pS)RGSIFTFR | 489.584 (+3) | 40.7 | b1 (+1) | (-) | y8 (+2) | (-) | 0.8 ± 0.09 (n = 3) |
| S539 | 536-DQG(pS)EADFADDENSTAGESESHR | 921.701 (+3) | 70.9 | b3 (+1) | b5 (+1) | y14 (+1) | (-) | 1.5 ± 0.09 (n = 9) |
| S549 | 534-RRDQGSEADFADDEN(pS)TAGESESHR | 769.579 (+4) | 55.3 | b15 (+2) | (-) | y9 (+1) | (-) | 3.2 (n = 1) |
| S560 | 559-T(pS)LLVPWPLR | 745.921 (+2) | 30.2 | b1 | b4 | y8 (+1) | (-) | 1.0 (n = 1) |
| S571 | 569-RP(pS)TQGQPGFGTSAPGHVLNGK | 911.466 (+3) | 55.2 | b1 (+1) | b7 (+1), b7 (+2) | y19 | (-) | 0.8 ± 0.03 (n = 19) |
| S581 | 569-RPSTQGQPGFGT(pS)APGHVLNGK | 683.856 (+4) | 48.5 | b12 (+2) | (-) | y8 (+2) | (-) | 0.9 (n = 1) |
| S593 | 591-RN(pS)TVDCNGVVSLLGAGDAEATSPGSHLLR | 841.660 (+4) | 71.7 | b2 | b3 | y16 (+1) | (-) | 0.8 ± 0.05 (n = 4) |
| S664 | 662-AL(pS)AVSVLTSALEELEESHRK | 936.506 (+3) | 60.6 | b2 (+1) | b5 (+1) | y18 (+2) | (-) | 1.0 ± 0.04 (n = 28) |
| S667 | 662-ALSAV(pS)VLTSALEELEESHR | 817.416 (+3) | 64.1 | b5 (+1) | b7 (+1) | y13 (+1) | (-) | 0.9 ± 0.06 (n = 12) |
| T670 | 662-ALSAVSVL(pT)SALEELEESHRK | 702.629 (+4) | 54.3 | b7 (+1) | (-) | y12 (+2) | (-) | 1.1 ± 0.1 (n = 4) |
| S671 | 662-ALSAVSVLT(pS)ALEELEESHRK | 702.629 (+4) | 63.2 | b9 (+2) | b10 (+2) | y11 (+2) | (-) | 1.7 ± 0.17 (n = 12)*** |
| S664 + S667 | 662-AL(pS)AV(pS)VLTSALEELEESHRK | 886.771 (+3) | 58.8 | b2 | b3 | y15 (+2) | y18 | 1.1 ± 0.05 (n = 18) |
| S664 + T670 | 662-AL(pS)AVSVL(pT)SALEELEESHR | 844.072 (+3) | 59.3 | b2 (+1) | b5 (+1), b8 (+1) | y11 (+1) | (-) | 1.0 ± 0.14 (n = 3) |
| S664 + S671 | 662-AL(pS)AVSVLT(pS)ALEELEESHR | 844.072 (+3) | 58.3 | b2 (+1) | b5 (+1), b9 (+2) | y10 (+1) | (-) | 1.8 ± 0.13 (n = 9)*** |
| S667 + T670 | 662-ALSAV(pS)VL(pT)SALEELEESHRK | 722.621 (+4) | 54.1 | b5 (+1) | b8 | y12 (+2) | (-) | 1.2 ± 0.37 (n = 4) |
| S667 + S671 | 662-ALSAV(pS)VLT(pS)ALEELEESHR | 844.073 (+3) | 60.5 | b5 (+1) | b8 (+1), b9 | y10 (+1) | (-) | 1.4 ± 0.17 (n = 7)** |
| T999 | 993-KPAALA(pT)HSQLPSCIAAPR | 824.114 (+3) | 48.8 | b6 (+1) | (-) | y12 (+1) | (-) | 0.8 (n = 1) |
| S1001 | 1001-(pS)QLPSCIAAPR | 503.591 (+3) | 32.6 | (-) | b2 (+1) | y8 (+1) | (-) | 1.0 ± 0.11 (n = 4) |
| S1005 | 993-KPAALATHSQLP(pS)CIAAPRSPPPPEVEKAPPAR | 702.389 (+6) | 71.4 | b11 (+2) | (-) | y18 (+2) | y21 (+2) | 0.8 ± 0.16 (n = 2) |
| S1012 | 1012-(pS)PPPPEVEK | 759.405 (+2) | 42.3 | (-) | b1 (+1) | y8 (+1) | (-) | 0.9 ± 0.03 (n = 17) |
| S1056 and/or T1058 | 1030-FEEDKRPGQGTPGDTEPVCVPIAVAESDTDDQEEDEENSLGTEEEESSK (1 Phospho) | 1230.559 (+5) | 57.3 | b24 (+2) | (-) | y11 (+1) | (-) | 1.8 ± 0.04 (n = 5) |
| T1105 | 1097-AWSQVSET(pT)SSEAEASTSQADWQQER | 1070.132 (+3) | 64.3 | b8 (+1) | b9 | y12 (+1) | (-) | 1.1 (n = 1) |
| S1107 | 1097-AWSQVSETTS(pS)EAEASTSQADWQQER | 1070.135 (+3) | 69.9 | b10 (+1) | b15 (+1) | y14 (+1) | (-) | 1.2 (n = 1) |
| S1138 | 1136-ED(pS)YSEGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEGCVR | 1312.582 (+4) | 44.7 | (-) | b3 (+1) | y23 (+2) | (-) | 1.3 ± 0.01 (n = 2) |
| T1809 | 1809-(pT)QFIEYLALSDFADALSEPLR | 903.451 (+3) | 54.8 | (-) | b1, b2 (+1) | y14 (+1) | (-) | 0.8 (n = 1) |
| S1937 | 1933-QQAG(pS)SGLSDEDAPER | 978.430 (+2) | 60.1 | b4 (+1) | (-) | y11 (+1) | (-) | 1.3 (n = 1) |
| S1964 | 1964-(pS)GPLSSSSISSTSFPPSYDSVTR | 885.752 (+3) | 50.3 | (-) | b1 (+1), b4 (+1) | y14 (+1) | (-) | 1.2 ± 0.11 (n = 3) |
| S1969 | 1964-SGPLS(pS)SSISSTSFPPSYDSVTR | 885.753 (+3) | 56.9 | b5 | b6 (+2) | y14 (+1) | (-) | 1.0 ± 0.04 (n = 3) |
| S1971 | 1963-RSGPLSSS(pS)ISSTSFPPSYDSVTR | 937.787 (+3) | 48.5 | b8 (+1) | (-) | y14 (+1) | (-) | 0.9 ± 0.09 (n = 3) |
| S1973 | 1964-SGPLSSSSI(pS)STSFPPSYDSVTR | 885.750 (+3) | 61.8 | b9 (+1) | b10 (+2) | y13 | (-) | 0.9 ± 0.02 (n = 6) |
| S1974 | 1964-SGPLSSSSIS(pS)TSFPPSYDSVTR | 885.750 (+3) | 61.8 | b10 | (-) | y12 (+1) | (-) | 0.9 ± 0.03 (n = 2) |
| S1989 | 1987-AT(pS)DNLPVR | 641.324 (+2) | 37.7 | b2 | b5 | y6 (+1) | (-) | 0.8 ± 0.07 (n = 2) |
| S2011 | 2002-SEDLADFPP(pS)PDRDR | 675.975 (+3) | 38.8 | b7 (+1) | (-) | y5 (+2) | y8 | 1.0 ± 0.05 (n = 15) |
| Phosphorylation site(s) | Phosphopeptide sequence | m/z (charge) | −10lgP score | b Ion | Phospho b ion | y Ion | Phospho y ion | TAC/sham ratio |
|---|---|---|---|---|---|---|---|---|
| S12 | 9-GTS(pS)FRR | 560.279 (+2) | 21.6 | b3 (+1) | (-) | y3 | (-) | 1.2 (n = 1) |
| S36 | 35-G(pS)ATSQESR | 616.279 (+2) | 32.1 | b1 | (-) | y7 | (-) | 1.3 (n = 1) |
| S42 | 35-GSATSQE(pS)REGLPEEEAPRPQLDLQASK | 887.947 (+4) | 73.1 | b7 (+1) | (-) | y19 (+2) | y21 (+2) | 1.5 ± 0.03 (n = 3) |
| S39 + S42 | 35-GSAT(pS)QE(pS)REGLPEEEAPRPQLDLQASK | 907.937 (+4) | 68.4 | b4 (+1) | (-) | y19 (+2) | y21 | 1.2 ± 0.12 (n = 2) |
| S457 (+ S459 or S460) | 452-GVDTV(pS)RSSLEMSPLAPVTNHER | 957.782 (+3) | 77.1 | b5 (+1) | b7 (−98) (+2) | y14 (+1) | (-) | 1.1 ± 0.09 (n = 10) |
| S459 + S460 | 452-GVDTVSR(pS)(pS)LEMSPLAPVTNHER | 958.117 (+3) | 41.5 | b7 (+2) | b11 (+2) | y12 (+1) | (-) | 1.2 (n = 1) |
| S460 | 459-S(pS)LEMSPLAPVTNHER | 1039.003 (+2) | 61.2 | b1 (+1) | b4 (+1) | y14 (+1) | (-) | 1.0 ± 0.05 (n = 18) |
| S483 | 481-RL(pS)SGTEDGGDDRLPK | 561.038 (+4) | 52.4 | b2 | b3 | y13 (+2) | (-) | 1.0 ± 0.03 (n = 10) |
| S484 | 482-LS(pS)GTEDGGDDR | 759.319 (+2) | 45.7 | b2 | (-) | y9 (+1) | (-) | 1.2 ± 0.07 (n = 12) |
| T486 | 484-SG(pT)EDGGDDRLPK | 628.973 (+3) | 21.9 | b1 | b5 | y8 (+2) | (-) | 1.2 (n = 1) |
| S483 + S484 | 480-KRL(pS)(pS)GTEDGGDDRLPK | 536.476 (+5) | 63 | b3 | (-) | y12 (+2) | (-) | 1.3 ± 0.04 (n = 19) |
| S497 | 482-LSSGTEDGGDDRLPK(pS)DSEDGPR | 732.845 (+4) | 60.2 | b12 (+2) | (-) | y7 (+1) | y12 | 1.3 ± 0.07 (n = 7) |
| S483 + S497 | 481-RL(pS)SGTEDGGDDRLPK(pS)DSEDGPR | 791.862 (+4) | 40.1 | b2 | b3 (−98) | y6 (+1) | y12 (+2) | 0.7 (n = 1) |
| S484 + S497 | 482-LS(pS)GTEDGGDDRLPK(pS)DSEDGPR | 1003.448 (+3) | 54.8 | b2 (+1) | b3 | y7 (+1) | y12 (+2) | 1.7 ± 0.04 (n = 2) |
| S499 | 497-SD(pS)EDGPR | 586.245 (+2) | 42 | b2 | b5 | y4 (+1) | y6 | 1.4 ± 0.17 (n = 3) |
| S510 | 505-ALNQL(pS)LTHGLSR | 573.643 (+3) | 51.8 | b4 (+1) | (-) | y7 (+1) | (-) | 0.9 ± 0.03 (n = 3) |
| S516 | 505-ALNQLSLTHGL(pS)R | 573.644 (+3) | 46.7 | b9 | (-) | y1 (+1) | (-) | 0.9 (n = 1) |
| S525 | 524-S(pS)RGSIFTFR | 489.584 (+3) | 40.7 | b1 (+1) | (-) | y8 (+2) | (-) | 0.8 ± 0.09 (n = 3) |
| S539 | 536-DQG(pS)EADFADDENSTAGESESHR | 921.701 (+3) | 70.9 | b3 (+1) | b5 (+1) | y14 (+1) | (-) | 1.5 ± 0.09 (n = 9) |
| S549 | 534-RRDQGSEADFADDEN(pS)TAGESESHR | 769.579 (+4) | 55.3 | b15 (+2) | (-) | y9 (+1) | (-) | 3.2 (n = 1) |
| S560 | 559-T(pS)LLVPWPLR | 745.921 (+2) | 30.2 | b1 | b4 | y8 (+1) | (-) | 1.0 (n = 1) |
| S571 | 569-RP(pS)TQGQPGFGTSAPGHVLNGK | 911.466 (+3) | 55.2 | b1 (+1) | b7 (+1), b7 (+2) | y19 | (-) | 0.8 ± 0.03 (n = 19) |
| S581 | 569-RPSTQGQPGFGT(pS)APGHVLNGK | 683.856 (+4) | 48.5 | b12 (+2) | (-) | y8 (+2) | (-) | 0.9 (n = 1) |
| S593 | 591-RN(pS)TVDCNGVVSLLGAGDAEATSPGSHLLR | 841.660 (+4) | 71.7 | b2 | b3 | y16 (+1) | (-) | 0.8 ± 0.05 (n = 4) |
| S664 | 662-AL(pS)AVSVLTSALEELEESHRK | 936.506 (+3) | 60.6 | b2 (+1) | b5 (+1) | y18 (+2) | (-) | 1.0 ± 0.04 (n = 28) |
| S667 | 662-ALSAV(pS)VLTSALEELEESHR | 817.416 (+3) | 64.1 | b5 (+1) | b7 (+1) | y13 (+1) | (-) | 0.9 ± 0.06 (n = 12) |
| T670 | 662-ALSAVSVL(pT)SALEELEESHRK | 702.629 (+4) | 54.3 | b7 (+1) | (-) | y12 (+2) | (-) | 1.1 ± 0.1 (n = 4) |
| S671 | 662-ALSAVSVLT(pS)ALEELEESHRK | 702.629 (+4) | 63.2 | b9 (+2) | b10 (+2) | y11 (+2) | (-) | 1.7 ± 0.17 (n = 12)*** |
| S664 + S667 | 662-AL(pS)AV(pS)VLTSALEELEESHRK | 886.771 (+3) | 58.8 | b2 | b3 | y15 (+2) | y18 | 1.1 ± 0.05 (n = 18) |
| S664 + T670 | 662-AL(pS)AVSVL(pT)SALEELEESHR | 844.072 (+3) | 59.3 | b2 (+1) | b5 (+1), b8 (+1) | y11 (+1) | (-) | 1.0 ± 0.14 (n = 3) |
| S664 + S671 | 662-AL(pS)AVSVLT(pS)ALEELEESHR | 844.072 (+3) | 58.3 | b2 (+1) | b5 (+1), b9 (+2) | y10 (+1) | (-) | 1.8 ± 0.13 (n = 9)*** |
| S667 + T670 | 662-ALSAV(pS)VL(pT)SALEELEESHRK | 722.621 (+4) | 54.1 | b5 (+1) | b8 | y12 (+2) | (-) | 1.2 ± 0.37 (n = 4) |
| S667 + S671 | 662-ALSAV(pS)VLT(pS)ALEELEESHR | 844.073 (+3) | 60.5 | b5 (+1) | b8 (+1), b9 | y10 (+1) | (-) | 1.4 ± 0.17 (n = 7)** |
| T999 | 993-KPAALA(pT)HSQLPSCIAAPR | 824.114 (+3) | 48.8 | b6 (+1) | (-) | y12 (+1) | (-) | 0.8 (n = 1) |
| S1001 | 1001-(pS)QLPSCIAAPR | 503.591 (+3) | 32.6 | (-) | b2 (+1) | y8 (+1) | (-) | 1.0 ± 0.11 (n = 4) |
| S1005 | 993-KPAALATHSQLP(pS)CIAAPRSPPPPEVEKAPPAR | 702.389 (+6) | 71.4 | b11 (+2) | (-) | y18 (+2) | y21 (+2) | 0.8 ± 0.16 (n = 2) |
| S1012 | 1012-(pS)PPPPEVEK | 759.405 (+2) | 42.3 | (-) | b1 (+1) | y8 (+1) | (-) | 0.9 ± 0.03 (n = 17) |
| S1056 and/or T1058 | 1030-FEEDKRPGQGTPGDTEPVCVPIAVAESDTDDQEEDEENSLGTEEEESSK (1 Phospho) | 1230.559 (+5) | 57.3 | b24 (+2) | (-) | y11 (+1) | (-) | 1.8 ± 0.04 (n = 5) |
| T1105 | 1097-AWSQVSET(pT)SSEAEASTSQADWQQER | 1070.132 (+3) | 64.3 | b8 (+1) | b9 | y12 (+1) | (-) | 1.1 (n = 1) |
| S1107 | 1097-AWSQVSETTS(pS)EAEASTSQADWQQER | 1070.135 (+3) | 69.9 | b10 (+1) | b15 (+1) | y14 (+1) | (-) | 1.2 (n = 1) |
| S1138 | 1136-ED(pS)YSEGSTADMTNTADLLEQIPDLGEDVKDPEDCFTEGCVR | 1312.582 (+4) | 44.7 | (-) | b3 (+1) | y23 (+2) | (-) | 1.3 ± 0.01 (n = 2) |
| T1809 | 1809-(pT)QFIEYLALSDFADALSEPLR | 903.451 (+3) | 54.8 | (-) | b1, b2 (+1) | y14 (+1) | (-) | 0.8 (n = 1) |
| S1937 | 1933-QQAG(pS)SGLSDEDAPER | 978.430 (+2) | 60.1 | b4 (+1) | (-) | y11 (+1) | (-) | 1.3 (n = 1) |
| S1964 | 1964-(pS)GPLSSSSISSTSFPPSYDSVTR | 885.752 (+3) | 50.3 | (-) | b1 (+1), b4 (+1) | y14 (+1) | (-) | 1.2 ± 0.11 (n = 3) |
| S1969 | 1964-SGPLS(pS)SSISSTSFPPSYDSVTR | 885.753 (+3) | 56.9 | b5 | b6 (+2) | y14 (+1) | (-) | 1.0 ± 0.04 (n = 3) |
| S1971 | 1963-RSGPLSSS(pS)ISSTSFPPSYDSVTR | 937.787 (+3) | 48.5 | b8 (+1) | (-) | y14 (+1) | (-) | 0.9 ± 0.09 (n = 3) |
| S1973 | 1964-SGPLSSSSI(pS)STSFPPSYDSVTR | 885.750 (+3) | 61.8 | b9 (+1) | b10 (+2) | y13 | (-) | 0.9 ± 0.02 (n = 6) |
| S1974 | 1964-SGPLSSSSIS(pS)TSFPPSYDSVTR | 885.750 (+3) | 61.8 | b10 | (-) | y12 (+1) | (-) | 0.9 ± 0.03 (n = 2) |
| S1989 | 1987-AT(pS)DNLPVR | 641.324 (+2) | 37.7 | b2 | b5 | y6 (+1) | (-) | 0.8 ± 0.07 (n = 2) |
| S2011 | 2002-SEDLADFPP(pS)PDRDR | 675.975 (+3) | 38.8 | b7 (+1) | (-) | y5 (+2) | y8 | 1.0 ± 0.05 (n = 15) |
The site-discriminating ions observed in MS/MS spectra of each annotated NaV1.5 (UniProt reference sequence K3W4N7) phosphopeptide support the assignment of the indicated phosphorylation site(s). The −10lgP scores attest to the quality of peptide identification. The manually verified charge state of unphosphorylated and phosphorylated site-discriminating b and y ions is reported in parentheses. (-) indicates that the ion was not detected. Mean ± SEM phosphopeptide abundance ratios in TAC left ventricles (n = 5) versus sham left ventricles (n = 4) mαNaVPAN-IPs were calculated from n phosphopeptide(s). **, P < 0.01; ***, P < 0.001; Mann-Whitney test. m/z, mass-to-charge ratio.
To determine whether phosphorylation of NaV1.5 is regulated in heart failure, the relative abundance of each NaV1.5 phosphopeptide in TAC versus sham mαNaVPAN-IPs was calculated using the relative abundance of TMT reporter ions. As illustrated in Fig. 1 D, peptides exhibiting phosphorylation(s) on serine 671 (S671) alone or in combination with serine 664 (S664 + S671) or serine 667 (S667 + S671) are significantly more abundant in the TAC than in the sham mαNaVPAN-IPs. The relative abundance of their nonphosphorylated counterparts, however, is similar in sham and TAC mαNaVPAN-IPs. None of the other NaV1.5 phosphopeptides showed any significant differences in the sham and TAC mαNaVPAN-IPs (Table 2). In addition to NaV1.5, four phosphorylation sites on NaV1.4 and one on NaV1.3 could also be detected (Table S3 and Data S1). Taken together, these quantitative phosphoproteomic analyses identified 42 native phosphorylation sites on NaV1.5, among which 3 clusters of phosphorylation in the first loop of the channel are highly phosphorylated in mouse left ventricles and one serine at position 671 shows increased phosphorylation in TAC mouse left ventricles.
Functional mapping of NaV1.5 channel phosphorylation clusters
The identification of several clusters of phosphorylation sites on NaV1.5 suggests that these sites may be involved in the coordinated regulation of channel expression and/or function. Of the eight clusters of phosphorylation identified in the mouse NaV1.5 protein, seven are conserved in the human NaV1.5 protein sequence; only the mouse T1105 is not conserved (Fig. S2). To investigate the functional roles of these (seven) phosphorylation clusters, phosphosilent and phosphomimetic NaV1.5 channel constructs in the human NaV1.5 hH1C cDNA sequence were generated, transiently expressed with the NaVβ1 channel subunit in HEK-293 cells, and characterized in whole-cell voltage-clamp recordings. In the phosphosilent constructs, mutations were introduced to replace serines/threonines (S/T) with alanines (A), whereas in the phosphomimetic constructs, mutations were introduced to substitute glutamates (E) for serines/threonines, to mimic phosphorylation.
Conservation of phosphorylation sites in mouse and human NaV1.5. The mouse (reference sequence NP_001240789.1) and human (NP_000326.2) NaV1.5 sequences are aligned, and phosphorylation sites identified on the mouse sequence and conserved in human are highlighted in red. Two phosphorylation site locations are possible at amino acids S1056-T1058 (in green). Transmembrane segments (S1-S6) in each domain (I–IV) are in bold and underlined in black; loops I, II, and III correspond to interdomains I–II, II–III, and III–IV, respectively. The seven phosphorylation clusters analyzed electrophysiologically are boxed in red. C-TERM, C terminus; N-TERM, N terminus.
Conservation of phosphorylation sites in mouse and human NaV1.5. The mouse (reference sequence NP_001240789.1) and human (NP_000326.2) NaV1.5 sequences are aligned, and phosphorylation sites identified on the mouse sequence and conserved in human are highlighted in red. Two phosphorylation site locations are possible at amino acids S1056-T1058 (in green). Transmembrane segments (S1-S6) in each domain (I–IV) are in bold and underlined in black; loops I, II, and III correspond to interdomains I–II, II–III, and III–IV, respectively. The seven phosphorylation clusters analyzed electrophysiologically are boxed in red. C-TERM, C terminus; N-TERM, N terminus.
As illustrated in Fig. 3 B, these whole-cell voltage-clamp analyses demonstrated that the voltage dependence of activation of the NaV1.5-S664-671A quadruple phosphosilent channels, in which all four of S664, S667, T670, and S671 are mutated to alanines, is significantly (P < 0.001) shifted toward depolarized potentials compared with WT channels (see distributions, detailed properties, and statistics in Fig. S3 A and Table 3). The activation curve of the NaV1.5-S664-671E quadruple phosphomimetic channel was also significantly (P < 0.001) shifted, although to a lesser extent, when compared with the phosphosilent channel. Together, therefore, these findings suggest that the S664-671 cluster is phosphorylated in HEK-293 cells and that disruption of phosphorylation at these sites shifts the voltage dependence of channel activation toward depolarized potentials. To further support the role of phosphorylation in this effect, the quadruple aspartate (D) phosphomimetic channel, NaV1.5-S664-671D, was generated, and analysis of voltage dependence of channel activation demonstrated no differences when compared with the WT channel (Fig. 3 B, Fig. S3 A, and Table 3). Consequent to these effects, the time to peak INa (Fig. 3 D), as well as the inactivation time constants, τfast and τslow (Fig. 3, E and F), of the NaV1.5-S664-671A and NaV1.5-S664-671E quadruple phosphomutant channels were shifted toward depolarized potentials compared with the WT NaV1.5 and the NaV1.5-S664-671D quadruple phosphomimetic channels, until reaching full activation at ∼0 mV. In addition, the peak INa density of the NaV1.5-S664-671E quadruple phosphomimetic channel was significantly (P < 0.05 at −20 mV) reduced compared with the WT channel, whereas no significant changes were observed with the NaV1.5-S664-671A and NaV1.5-S664-671D quadruple phosphomutant channels (Fig. 3 C; see distributions at −20 mV and statistics in Fig. S3 B and Table 3). Importantly, however, evaluation and comparison of the peak INa densities of these four channel constructs is impeded by the differences in voltage dependence of activation, and no significant differences in peak INa densities (at −20 or 0 mV) or maximal Na+ G values (data not shown) were observed for the NaV1.5-S664-671D, compared with WT, channels. Finally, the voltage dependence of steady-state inactivation (Fig. 3 B, Fig. S3 C, and Table 3) and the kinetics of recovery from inactivation (Fig. S3 D and Table 3) of the NaV1.5-S664-671A and NaV1.5-S664-671E quadruple phosphomutant channels were similar to those of the WT channels. Additionally, and to our surprise, no differences in current densities, in the kinetics or voltage dependences of current activation and inactivation, or in the kinetics of recovery from inactivation were observed for any of the six other heterologously expressed (in HEK-293 cells) paired phosphosilent or phosphomimetic NaV1.5 channels (Fig. S3 and Table 3). Taken together, therefore, these analyses suggest a key role for phosphorylation at S664-671 in regulating the voltage dependence of NaV1.5 channel activation and peak INa density, whereas the functional impact of the other phosphorylation sites most likely involves more complex mechanisms.
The phosphorylation sites at positions S664 - 671 regulate the voltage dependence of current activation and peak INa density. (A) Representative whole-cell voltage-gated INa recorded 48 h following transfection of HEK-293 cells with NaV1.5-WT + NaVβ1 (black), NaV1.5-S664-671A + NaVβ1 (blue), NaV1.5-S664-671E + NaVβ1 (red), or NaV1.5-S664-671D + NaVβ1 (green) using the protocols illustrated in each panel. Scale bars are 1 nA and 2 ms. (B) Voltage dependences of current activation and steady-state inactivation. The voltage dependence of current activation is shifted toward depolarized potentials in cells expressing the NaV1.5-S664-671A or NaV1.5-S664-671E quadruple phosphomutants compared with cells expressing NaV1.5-WT or the NaV1.5-S664-671D quadruple phosphomimetic channels. (C) Mean ± SEM peak INa densities plotted as a function of test potential. The peak INa density is reduced in cells expressing the NaV1.5-S664-671E mutant compared with cells expressing NaV1.5-WT. (D–F) Mean ± SEM times to peak (D), fast (τfast; E), and slow (τslow; F) inactivation time constants plotted as a function of test potential. The times to peak, τfast, and τslow are higher in cells expressing the NaV1.5-S664-671A or NaV1.5-S664-671E quadruple phosphomutants than in cells expressing NaV1.5-WT or NaV1.5-S664-671D. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Fig. S3 and Table 3. GNa, sodium conductance.
The phosphorylation sites at positions S664 - 671 regulate the voltage dependence of current activation and peak INa density. (A) Representative whole-cell voltage-gated INa recorded 48 h following transfection of HEK-293 cells with NaV1.5-WT + NaVβ1 (black), NaV1.5-S664-671A + NaVβ1 (blue), NaV1.5-S664-671E + NaVβ1 (red), or NaV1.5-S664-671D + NaVβ1 (green) using the protocols illustrated in each panel. Scale bars are 1 nA and 2 ms. (B) Voltage dependences of current activation and steady-state inactivation. The voltage dependence of current activation is shifted toward depolarized potentials in cells expressing the NaV1.5-S664-671A or NaV1.5-S664-671E quadruple phosphomutants compared with cells expressing NaV1.5-WT or the NaV1.5-S664-671D quadruple phosphomimetic channels. (C) Mean ± SEM peak INa densities plotted as a function of test potential. The peak INa density is reduced in cells expressing the NaV1.5-S664-671E mutant compared with cells expressing NaV1.5-WT. (D–F) Mean ± SEM times to peak (D), fast (τfast; E), and slow (τslow; F) inactivation time constants plotted as a function of test potential. The times to peak, τfast, and τslow are higher in cells expressing the NaV1.5-S664-671A or NaV1.5-S664-671E quadruple phosphomutants than in cells expressing NaV1.5-WT or NaV1.5-S664-671D. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Fig. S3 and Table 3. GNa, sodium conductance.
Distributions and mean ± SEM membrane potentials for half-activation and half-inactivation, peak I Na densities, and time constants of recovery from inactivation of WT and mutant Na V 1.5 channels. Half-activation (A), peak INa densities (B), half-inactivation (C), and time constants of recovery from inactivation (D) of WT and mutant NaV1.5 channels. Currents were recorded as described in the legend to Fig. 3. The INa densities presented were determined from analyses of records obtained on depolarizations to −20 mV (HP = −120 mV). #, P < 0.05 versus NaV1.5-WT, one-way ANOVA followed by the Dunnett’s post-hoc test. ***, P < 0.001 versus NaV1.5-WT, Kruskal-Wallis followed by the Dunn’s post-hoc test. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Table 3.
Distributions and mean ± SEM membrane potentials for half-activation and half-inactivation, peak I Na densities, and time constants of recovery from inactivation of WT and mutant Na V 1.5 channels. Half-activation (A), peak INa densities (B), half-inactivation (C), and time constants of recovery from inactivation (D) of WT and mutant NaV1.5 channels. Currents were recorded as described in the legend to Fig. 3. The INa densities presented were determined from analyses of records obtained on depolarizations to −20 mV (HP = −120 mV). #, P < 0.05 versus NaV1.5-WT, one-way ANOVA followed by the Dunnett’s post-hoc test. ***, P < 0.001 versus NaV1.5-WT, Kruskal-Wallis followed by the Dunn’s post-hoc test. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Table 3.
Current densities and properties of NaV1.5 channels mutant for the phosphorylation clusters in transiently transfected HEK-293 cells
| INa (pA/pF) | Time to peak (ms) | Time course of inactivation | Voltage-dependence of activation | Voltage-dependence of inactivation | Recovery from inactivation | |||||
|---|---|---|---|---|---|---|---|---|---|---|
| τfast (ms) | τslow (ms) | Afast/Aslow | V1/2 (mV) | k (mV) | V1/2 (mV) | k (mV) | τrec (ms) | |||
| NaV1.5-WT | −130.8 ± 13.1 (25) | 0.60 ± 0.01 (19) | 0.72 ± 0.02 (18) | 3.6 ± 0.2 (18) | 15.5 ± 1.0 (18) | −45.7 ± 0.6 (19) | 6.8 ± 0.2 (19) | −88.3 ± 0.6 (19) | 4.9 ± 0.1 (19) | 8.7 ± 0.6 (19) |
| NaV1.5-S36-42A | −115.7 ± 11.2 (35) | 0.63 ± 0.02 (19) | 0.75 ± 0.02 (19) | 3.6 ± 0.2 (19) | 13.3 ± 1.0 (19) | −44.7 ± 0.6 (19) | 6.7 ± 0.1 (19) | −86.5 ± 0.8 (19) | 4.9 ± 0.1 (19) | 7.1 ± 0.6 (18) |
| NaV1.5-S36-42E | −92.2 ± 11.4 (31) | 0.59 ± 0.02 (19) | 0.72 ± 0.02 (17) | 3.5 ± 0.2 (17) | 13.6 ± 1.9 (17) | −45.2 ± 0.6 (19) | 6.6 ± 0.1 (19) | −86.1 ± 0.5 (19) | 4.6 ± 0.1 (19) | 7.3 ± 0.3 (18) |
| NaV1.5-S457-460A | −136.5 ± 12.1 (24) | 0.60 ± 0.01 (18) | 0.75 ± 0.02 (18) | 4.6 ± 0.4 (18) | 15.6 ± 1.2 (18) | −45.4 ± 0.7 (18) | 7.0 ± 0.2 (18) | −90.0 ± 0.9 (18) | 5.2 ± 0.1 (18) | 9.3 ± 0.5 (18) |
| NaV1.5-S457-460E | −123.3 ± 11.6 (28) | 0.60 ± 0.02 (20) | 0.74 ± 0.02 (19) | 3.7 ± 0.2 (19) | 17.5 ± 1.8 (19) | −45.2 ± 0.4 (20) | 6.8 ± 0.1 (20) | −87.5 ± 0.5 (19) | 4.7 ± 0.1 (19) | 8.7 ± 0.4 (19) |
| NaV1.5-S483-486A | −104.7 ± 11.3 (40) | 0.61 ± 0.02 (28) | 0.61 ± 0.02 (26) | 3.2 ± 0.1 (26) | 12.7 ± 1.0 (26) | −47.1 ± 0.6 (28) | 6.3 ± 0.2 (28) | −89.1 ± 0.7 (28) | 5.0 ± 0.1 (28) | 7.1 ± 0.5 (26) |
| NaV1.5-S483-486E | −117.4 ± 10.4 (29) | 0.55 ± 0.02 (19) | 0.59 ± 0.02 (16) | 2.9 ± 0.2 (16) | 14.2 ± 1.2 (16) | −48.2 ± 0.6 (19) | 6.3 ± 0.2 (19) | −89.6 ± 0.6 (19) | 4.8 ± 0.1 (19) | 8.2 ± 0.6 (16) |
| NaV1.5-S497-499A | −110.5 ± 13.5 (25) | 0.62 ± 0.02 (16) | 0.76 ± 0.03 (12) | 4.6 ± 0.4 (12) | 18.0 ± 1.4 (12) | −44.6 ± 0.6 (16) | 7.1 ± 0.1 (16) | −88.4 ± 0.7 (16) | 4.8 ± 0.1 (16) | 8.8 ± 0.7 (15) |
| NaV1.5-S497-499E | −129.5 ± 13.8 (22) | 0.56 ± 0.01 (18) | 0.70 ± 0.02 (17) | 3.8 ± 0.2 (17) | 16.7 ± 1.0 (17) | −46.7 ± 0.5 (18) | 7.2 ± 0.1 (18) | −90.2 ± 0.7 (18) | 4.9 ± 0.1 (18) | 9.5 ± 0.6 (18) |
| NaV1.5-S664-671A | −109.8 ± 11.8 (19) | 0.83 ± 0.02*** (18) | 0.89 ± 0.02** (17) | 5.5 ± 0.5* (17) | 18.1 ± 1.2 (17) | −35.1 ± 0.6*** (18) | 7.3 ± 0.1 (18) | −87.1 ± 0.6 (18) | 5.4 ± 0.1 (18) | 8.4 ± 0.4 (18) |
| NaV1.5-S664-671E | −74.5 ± 10.2# (23) | 0.80 ± 0.02*** (18) | 0.90 ± 0.03* (15) | 4.9 ± 0.4 (15) | 18.8 ± 1.9 (15) | −39.1 ± 0.4*** (18) | 7.0 ± 0.1 (18) | −86.1 ± 0.8 (18) | 5.1 ± 0.1 (18) | 7.7 ± 0.6 (16) |
| NaV1.5-S664-671D | −92.2 ± 13.2 (18) | 0.65 ± 0.02 (14) | 0.77 ± 0.03 (12) | 3.7 ± 0.2 (12) | 15.5 ± 1.7 (12) | −48.7 ± 0.6 (14) | 5.9 ± 0.2 (14) | |||
| NaV1.5-S1003-1010A | −103.0 ± 8.5 (38) | 0.62 ± 0.01 (19) | 0.76 ± 0.02 (19) | 4.2 ± 0.2 (19) | 7.4 ± 0.7 (19) | −45.3 ± 0.5 (19) | 6.5 ± 0.2 (19) | −86.6 ± 0.7 (19) | 6.0 ± 0.2 (19) | 6.7 ± 0.6 (19) |
| NaV1.5-S1003-1010E | −99.9 ± 11.9 (23) | 0.61 ± 0.01 (15) | 0.74 ± 0.02 (15) | 3.9 ± 0.1 (15) | 7.8 ± 0.6 (15) | −45.8 ± 0.8 (15) | 6.5 ± 0.2 (15) | −86.2 ± 0.8 (15) | 5.6 ± 0.2 (15) | 6.4 ± 0.5 (13) |
| NaV1.5-S1964-1969A | −115.0 ± 7.4 (23) | 0.63 ± 0.01 (21) | 0.77 ± 0.02 (20) | 4.1 ± 0.2 (20) | 15.8 ± 0.9 (20) | −44.9 ± 0.5 (21) | 6.6 ± 0.2 (21) | −87.6 ± 0.5 (21) | 5.1 ± 0.1 (21) | 7.8 ± 0.4 (18) |
| NaV1.5-S1964-1969E | −132.8 ± 18.3 (26) | 0.66 ± 0.02 (17) | 0.81 ± 0.02 (15) | 4.0 ± 0.2 (15) | 13.9 ± 0.8 (15) | −44.1 ± 0.6 (17) | 7.2 ± 0.2 (17) | −89.3 ± 0.8 (17) | 4.9 ± 0.1 (17) | 9.3 ± 0.8 (15) |
| INa (pA/pF) | Time to peak (ms) | Time course of inactivation | Voltage-dependence of activation | Voltage-dependence of inactivation | Recovery from inactivation | |||||
|---|---|---|---|---|---|---|---|---|---|---|
| τfast (ms) | τslow (ms) | Afast/Aslow | V1/2 (mV) | k (mV) | V1/2 (mV) | k (mV) | τrec (ms) | |||
| NaV1.5-WT | −130.8 ± 13.1 (25) | 0.60 ± 0.01 (19) | 0.72 ± 0.02 (18) | 3.6 ± 0.2 (18) | 15.5 ± 1.0 (18) | −45.7 ± 0.6 (19) | 6.8 ± 0.2 (19) | −88.3 ± 0.6 (19) | 4.9 ± 0.1 (19) | 8.7 ± 0.6 (19) |
| NaV1.5-S36-42A | −115.7 ± 11.2 (35) | 0.63 ± 0.02 (19) | 0.75 ± 0.02 (19) | 3.6 ± 0.2 (19) | 13.3 ± 1.0 (19) | −44.7 ± 0.6 (19) | 6.7 ± 0.1 (19) | −86.5 ± 0.8 (19) | 4.9 ± 0.1 (19) | 7.1 ± 0.6 (18) |
| NaV1.5-S36-42E | −92.2 ± 11.4 (31) | 0.59 ± 0.02 (19) | 0.72 ± 0.02 (17) | 3.5 ± 0.2 (17) | 13.6 ± 1.9 (17) | −45.2 ± 0.6 (19) | 6.6 ± 0.1 (19) | −86.1 ± 0.5 (19) | 4.6 ± 0.1 (19) | 7.3 ± 0.3 (18) |
| NaV1.5-S457-460A | −136.5 ± 12.1 (24) | 0.60 ± 0.01 (18) | 0.75 ± 0.02 (18) | 4.6 ± 0.4 (18) | 15.6 ± 1.2 (18) | −45.4 ± 0.7 (18) | 7.0 ± 0.2 (18) | −90.0 ± 0.9 (18) | 5.2 ± 0.1 (18) | 9.3 ± 0.5 (18) |
| NaV1.5-S457-460E | −123.3 ± 11.6 (28) | 0.60 ± 0.02 (20) | 0.74 ± 0.02 (19) | 3.7 ± 0.2 (19) | 17.5 ± 1.8 (19) | −45.2 ± 0.4 (20) | 6.8 ± 0.1 (20) | −87.5 ± 0.5 (19) | 4.7 ± 0.1 (19) | 8.7 ± 0.4 (19) |
| NaV1.5-S483-486A | −104.7 ± 11.3 (40) | 0.61 ± 0.02 (28) | 0.61 ± 0.02 (26) | 3.2 ± 0.1 (26) | 12.7 ± 1.0 (26) | −47.1 ± 0.6 (28) | 6.3 ± 0.2 (28) | −89.1 ± 0.7 (28) | 5.0 ± 0.1 (28) | 7.1 ± 0.5 (26) |
| NaV1.5-S483-486E | −117.4 ± 10.4 (29) | 0.55 ± 0.02 (19) | 0.59 ± 0.02 (16) | 2.9 ± 0.2 (16) | 14.2 ± 1.2 (16) | −48.2 ± 0.6 (19) | 6.3 ± 0.2 (19) | −89.6 ± 0.6 (19) | 4.8 ± 0.1 (19) | 8.2 ± 0.6 (16) |
| NaV1.5-S497-499A | −110.5 ± 13.5 (25) | 0.62 ± 0.02 (16) | 0.76 ± 0.03 (12) | 4.6 ± 0.4 (12) | 18.0 ± 1.4 (12) | −44.6 ± 0.6 (16) | 7.1 ± 0.1 (16) | −88.4 ± 0.7 (16) | 4.8 ± 0.1 (16) | 8.8 ± 0.7 (15) |
| NaV1.5-S497-499E | −129.5 ± 13.8 (22) | 0.56 ± 0.01 (18) | 0.70 ± 0.02 (17) | 3.8 ± 0.2 (17) | 16.7 ± 1.0 (17) | −46.7 ± 0.5 (18) | 7.2 ± 0.1 (18) | −90.2 ± 0.7 (18) | 4.9 ± 0.1 (18) | 9.5 ± 0.6 (18) |
| NaV1.5-S664-671A | −109.8 ± 11.8 (19) | 0.83 ± 0.02*** (18) | 0.89 ± 0.02** (17) | 5.5 ± 0.5* (17) | 18.1 ± 1.2 (17) | −35.1 ± 0.6*** (18) | 7.3 ± 0.1 (18) | −87.1 ± 0.6 (18) | 5.4 ± 0.1 (18) | 8.4 ± 0.4 (18) |
| NaV1.5-S664-671E | −74.5 ± 10.2# (23) | 0.80 ± 0.02*** (18) | 0.90 ± 0.03* (15) | 4.9 ± 0.4 (15) | 18.8 ± 1.9 (15) | −39.1 ± 0.4*** (18) | 7.0 ± 0.1 (18) | −86.1 ± 0.8 (18) | 5.1 ± 0.1 (18) | 7.7 ± 0.6 (16) |
| NaV1.5-S664-671D | −92.2 ± 13.2 (18) | 0.65 ± 0.02 (14) | 0.77 ± 0.03 (12) | 3.7 ± 0.2 (12) | 15.5 ± 1.7 (12) | −48.7 ± 0.6 (14) | 5.9 ± 0.2 (14) | |||
| NaV1.5-S1003-1010A | −103.0 ± 8.5 (38) | 0.62 ± 0.01 (19) | 0.76 ± 0.02 (19) | 4.2 ± 0.2 (19) | 7.4 ± 0.7 (19) | −45.3 ± 0.5 (19) | 6.5 ± 0.2 (19) | −86.6 ± 0.7 (19) | 6.0 ± 0.2 (19) | 6.7 ± 0.6 (19) |
| NaV1.5-S1003-1010E | −99.9 ± 11.9 (23) | 0.61 ± 0.01 (15) | 0.74 ± 0.02 (15) | 3.9 ± 0.1 (15) | 7.8 ± 0.6 (15) | −45.8 ± 0.8 (15) | 6.5 ± 0.2 (15) | −86.2 ± 0.8 (15) | 5.6 ± 0.2 (15) | 6.4 ± 0.5 (13) |
| NaV1.5-S1964-1969A | −115.0 ± 7.4 (23) | 0.63 ± 0.01 (21) | 0.77 ± 0.02 (20) | 4.1 ± 0.2 (20) | 15.8 ± 0.9 (20) | −44.9 ± 0.5 (21) | 6.6 ± 0.2 (21) | −87.6 ± 0.5 (21) | 5.1 ± 0.1 (21) | 7.8 ± 0.4 (18) |
| NaV1.5-S1964-1969E | −132.8 ± 18.3 (26) | 0.66 ± 0.02 (17) | 0.81 ± 0.02 (15) | 4.0 ± 0.2 (15) | 13.9 ± 0.8 (15) | −44.1 ± 0.6 (17) | 7.2 ± 0.2 (17) | −89.3 ± 0.8 (17) | 4.9 ± 0.1 (17) | 9.3 ± 0.8 (15) |
Whole-cell voltage-gated INa were recorded 48 h following transfection of HEK-293 cells with the WT or the mutant NaV1.5 channels and the NaVβ1 channel subunit using the protocols described in the Materials and methods section. The peak INa density, time to peak, and time course of inactivation properties presented were determined from analyses of records obtained on depolarizations to −20 mV (HP = −120 mV). All values are means ± SEMs. The number of cells analyzed is provided in parentheses. #, P < 0.05 versus NaV1.5-WT, one-way ANOVA followed by Dunnett’s post-hoc test. *, P < 0.05; **, P < 0.01; ***, P < 0.001 versus NaV1.5-WT; Kruskal-Wallis followed by Dunn’s post-hoc test.
The S664 and S667 phosphorylation sites regulate the voltage dependence of current activation, whereas S671 regulates the peak INa density
To decipher the respective contributions of the S664, S667, T670, and S671 phosphorylation sites in regulating the voltage dependence of current activation and peak INa density, each of these serine/threonine residues was mutated individually to alanine or glutamate, and the densities and properties of INa produced by the single phosphosilent or phosphomimetic channel mutants, coexpressed transiently with the accessory NaVβ1 subunit in HEK-293 cells, were determined. These analyses showed that the voltage dependences of activation of the NaV1.5-S664 (Fig. 4 A) and NaV1.5-S667 (Fig. 4 B) phosphomutant channels are significantly (P < 0.001) shifted toward depolarized potentials compared with the WT channels, whereas no changes were observed with the NaV1.5-T670 or NaV1.5-S671 phosphomutant channels (Fig. 4, C and D; see detailed properties and statistics in Table 4). Of note, the ∼6-mV shifts observed with the NaV1.5-S664A and NaV1.5-S667A single phosphosilent channels were twofold smaller than the ∼10-mV shift obtained with the NaV1.5-S664-671A quadruple phosphosilent channel, suggesting that the effects at S664 and S667 are additive. Regarding the analysis of the peak INa densities, only the NaV1.5-S671E phosphomimetic channel showed a significant (P < 0.05) decrease, compared with the WT channel (Fig. 4 H), whereas no significant differences were observed with any of the other single phosphomutant channels (Fig. 4, E–G).
The S664 and S667 phosphorylation sites regulate the voltage dependence of current activation, whereas the S671 phosphorylation site regulates the peak INa density. Currents were recorded as described in the legend to Fig. 3. (A–D) The voltage dependence of current activation is shifted toward more depolarized potentials in cells expressing NaV1.5-S664A (A), NaV1.5-S664E (A), NaV1.5-S667A (B), or NaV1.5-S667E (B) than in cells expressing NaV1.5-WT, whereas no significant differences are observed with the NaV1.5-T670 (C) or NaV1.5-S671 (D) phosphomutants. (E–H) The mean ± SEM peak INa densities are plotted as a function of test potential. The peak INa density is reduced in cells expressing NaV1.5-S671E (H), compared with cells expressing NaV1.5-WT, whereas no significant differences are observed with the other phosphomutants. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Table 4. GNa, sodium conductance.
The S664 and S667 phosphorylation sites regulate the voltage dependence of current activation, whereas the S671 phosphorylation site regulates the peak INa density. Currents were recorded as described in the legend to Fig. 3. (A–D) The voltage dependence of current activation is shifted toward more depolarized potentials in cells expressing NaV1.5-S664A (A), NaV1.5-S664E (A), NaV1.5-S667A (B), or NaV1.5-S667E (B) than in cells expressing NaV1.5-WT, whereas no significant differences are observed with the NaV1.5-T670 (C) or NaV1.5-S671 (D) phosphomutants. (E–H) The mean ± SEM peak INa densities are plotted as a function of test potential. The peak INa density is reduced in cells expressing NaV1.5-S671E (H), compared with cells expressing NaV1.5-WT, whereas no significant differences are observed with the other phosphomutants. Current densities, time- and voltage-dependent properties, and statistical comparisons across groups are provided in Table 4. GNa, sodium conductance.
Current densities and properties of NaV1.5 channels mutant for S664, S667, T670, and S671 in transiently transfected HEK-293 cells
| INa (pA/pF) | Time to peak (ms) | Time course of inactivation | Voltage dependence of activation | Voltage dependence of inactivation | Recovery from inactivation | |||||
|---|---|---|---|---|---|---|---|---|---|---|
| τfast (ms) | τslow (ms) | Afast/Aslow | V1/2 (mV) | k (mV) | V1/2 (mV) | k (mV) | τrec (ms) | |||
| NaV1.5-WT | −162.5 ± 18.0 (23) | 0.62 ± 0.02 (21) | 0.75 ± 0.02 (19) | 3.3 ± 0.2 (19) | 13.8 ± 1.5 (19) | −45.7 ± 0.6 (21) | 6.0 ± 0.2 (21) | −85.0 ± 0.6 (21) | 4.7 ± 0.1 (21) | 6.0 ± 0.4 (17) |
| NaV1.5-S664A | −145.2 ± 17.4 (24) | 0.75 ± 0.01* (22) | 0.82 ± 0.02 (21) | 4.1 ± 0.2 (21) | 16.7 ± 1.4 (21) | −38.9 ± 0.5*** (22) | 6.6 ± 0.1 (22) | −84.0 ± 0.7 (22) | 4.8 ± 0.1 (22) | 6.6 ± 0.6 (22) |
| NaV1.5-S664E | −133.6 ± 15.4 (23) | 0.73 ± 0.02 (19) | 0.79 ± 0.03 (14) | 3.3 ± 0.2 (14) | 11.7 ± 1.1 (14) | −39.0 ± 0.6*** (19) | 6.7 ± 0.1 (19) | −83.4 ± 0.8 (19) | 4.7 ± 0.1 (19) | 6.1 ± 0.5 (19) |
| NaV1.5-S667A | −155.3 ± 14.6 (23) | 0.75 ± 0.02 (19) | 0.78 ± 0.03 (16) | 3.9 ± 0.2 (16) | 14.1 ± 1.0 (16) | −39.4 ± 0.5*** (19) | 6.3 ± 0.2 (19) | −83.7 ± 0.6 (19) | 4.9 ± 0.1 (19) | 6.0 ± 0.4 (16) |
| NaV1.5-S667E | −126.7 ± 16.0 (22) | 0.76 ± 0.02* (19) | 0.81 ± 0.02 (14) | 4.0 ± 0.2 (14) | 14.9 ± 1.3 (14) | −39.5 ± 0.7*** (19) | 6.6 ± 0.1 (19) | −83.8 ± 0.9 (19) | 4.7 ± 0.1 (19) | 6.7 ± 0.7 (19) |
| NaV1.5-T670A | −157.2 ± 16.0 (19) | 0.63 ± 0.02 (19) | 0.64 ± 0.02 (18) | 3.0 ± 0.2 (18) | 11.2 ± 1.5 (18) | −45.1 ± 0.6 (19) | 5.4 ± 0.2 (19) | −86.9 ± 0.9 (16) | 4.8 ± 0.1 (16) | 8.4 ± 0.6 (14) |
| NaV1.5-T670E | −125.7 ± 10.5 (25) | 0.59 ± 0.02 (25) | 0.70 ± 0.02 (22) | 3.5 ± 0.4 (22) | 14.3 ± 1.9 (22) | −46.2 ± 0.7 (25) | 6.3 ± 0.2 (25) | −87.7 ± 1.0 (20) | 4.6 ± 0.1 (20) | 9.8 ± 1.0 (20) |
| NaV1.5-S671A | −130.7 ± 13.7 (35) | 0.54 ± 0.02 (34) | 0.59 ± 0.02 (25) | 2.3 ± 0.1 (25) | 10.3 ± 0.9 (25) | −44.4 ± 0.5 (34) | 6.5 ± 0.1 (34) | −84.9 ± 0.6 (32) | 4.5 ± 0.1 (32) | 5.6 ± 0.3 (30) |
| NaV1.5-S671E | −100.6 ± 13.8# (25) | 0.52 ± 0.01 (23) | 0.65 ± 0.02 (11) | 2.7 ± 0.3 (11) | 9.9 ± 1.6 (11) | −45.0 ± 0.5 (23) | 6.8 ± 0.1 (23) | −86.1 ± 0.5 (23) | 4.4 ± 0.1 (23) | 6.4 ± 0.3 (21) |
| INa (pA/pF) | Time to peak (ms) | Time course of inactivation | Voltage dependence of activation | Voltage dependence of inactivation | Recovery from inactivation | |||||
|---|---|---|---|---|---|---|---|---|---|---|
| τfast (ms) | τslow (ms) | Afast/Aslow | V1/2 (mV) | k (mV) | V1/2 (mV) | k (mV) | τrec (ms) | |||
| NaV1.5-WT | −162.5 ± 18.0 (23) | 0.62 ± 0.02 (21) | 0.75 ± 0.02 (19) | 3.3 ± 0.2 (19) | 13.8 ± 1.5 (19) | −45.7 ± 0.6 (21) | 6.0 ± 0.2 (21) | −85.0 ± 0.6 (21) | 4.7 ± 0.1 (21) | 6.0 ± 0.4 (17) |
| NaV1.5-S664A | −145.2 ± 17.4 (24) | 0.75 ± 0.01* (22) | 0.82 ± 0.02 (21) | 4.1 ± 0.2 (21) | 16.7 ± 1.4 (21) | −38.9 ± 0.5*** (22) | 6.6 ± 0.1 (22) | −84.0 ± 0.7 (22) | 4.8 ± 0.1 (22) | 6.6 ± 0.6 (22) |
| NaV1.5-S664E | −133.6 ± 15.4 (23) | 0.73 ± 0.02 (19) | 0.79 ± 0.03 (14) | 3.3 ± 0.2 (14) | 11.7 ± 1.1 (14) | −39.0 ± 0.6*** (19) | 6.7 ± 0.1 (19) | −83.4 ± 0.8 (19) | 4.7 ± 0.1 (19) | 6.1 ± 0.5 (19) |
| NaV1.5-S667A | −155.3 ± 14.6 (23) | 0.75 ± 0.02 (19) | 0.78 ± 0.03 (16) | 3.9 ± 0.2 (16) | 14.1 ± 1.0 (16) | −39.4 ± 0.5*** (19) | 6.3 ± 0.2 (19) | −83.7 ± 0.6 (19) | 4.9 ± 0.1 (19) | 6.0 ± 0.4 (16) |
| NaV1.5-S667E | −126.7 ± 16.0 (22) | 0.76 ± 0.02* (19) | 0.81 ± 0.02 (14) | 4.0 ± 0.2 (14) | 14.9 ± 1.3 (14) | −39.5 ± 0.7*** (19) | 6.6 ± 0.1 (19) | −83.8 ± 0.9 (19) | 4.7 ± 0.1 (19) | 6.7 ± 0.7 (19) |
| NaV1.5-T670A | −157.2 ± 16.0 (19) | 0.63 ± 0.02 (19) | 0.64 ± 0.02 (18) | 3.0 ± 0.2 (18) | 11.2 ± 1.5 (18) | −45.1 ± 0.6 (19) | 5.4 ± 0.2 (19) | −86.9 ± 0.9 (16) | 4.8 ± 0.1 (16) | 8.4 ± 0.6 (14) |
| NaV1.5-T670E | −125.7 ± 10.5 (25) | 0.59 ± 0.02 (25) | 0.70 ± 0.02 (22) | 3.5 ± 0.4 (22) | 14.3 ± 1.9 (22) | −46.2 ± 0.7 (25) | 6.3 ± 0.2 (25) | −87.7 ± 1.0 (20) | 4.6 ± 0.1 (20) | 9.8 ± 1.0 (20) |
| NaV1.5-S671A | −130.7 ± 13.7 (35) | 0.54 ± 0.02 (34) | 0.59 ± 0.02 (25) | 2.3 ± 0.1 (25) | 10.3 ± 0.9 (25) | −44.4 ± 0.5 (34) | 6.5 ± 0.1 (34) | −84.9 ± 0.6 (32) | 4.5 ± 0.1 (32) | 5.6 ± 0.3 (30) |
| NaV1.5-S671E | −100.6 ± 13.8# (25) | 0.52 ± 0.01 (23) | 0.65 ± 0.02 (11) | 2.7 ± 0.3 (11) | 9.9 ± 1.6 (11) | −45.0 ± 0.5 (23) | 6.8 ± 0.1 (23) | −86.1 ± 0.5 (23) | 4.4 ± 0.1 (23) | 6.4 ± 0.3 (21) |
Whole-cell voltage-gated INa were recorded 48 h following transfection of HEK-293 cells with the WT or the mutant NaV1.5 channels and the NaVβ1 channel subunit using the protocols described in the Materials and methods section. The peak INa density, time to peak, and time course of inactivation properties presented were determined from analyses of records obtained on depolarizations to −20 mV (HP = −120 mV). All values are means ± SEMs. The number of cells analyzed is provided in parentheses. #, P < 0.05 versus NaV1.5-WT, one-way ANOVA followed by Dunnett’s post-hoc test. *, P < 0.05; ***, P < 0.001 versus NaV1.5-WT; Kruskal-Wallis followed by Dunn’s post-hoc test.
Because phosphorylation at S671 was found to be increased in the TAC, compared with the sham, mαNaVPAN-IPs (Fig. 1 D), and because it was previously suggested that phosphorylation of NaV1.5 may mediate increased INaL in heart failure (Wagner et al., 2006; Maltsev et al., 2008; Koval et al., 2012; Aiba et al., 2013; Toischer et al., 2013; Glynn et al., 2015), additional voltage-clamp experiments were designed to test whether phosphorylation at S671 regulates INaL. These analyses showed that none of the single mutations at S671 or quadruple mutations at S664-671 affect TTX-sensitive INaL density in HEK-293 cells (Fig. S4). Altogether, therefore, these analyses suggest that phosphorylation at S664 and S667 shifts the voltage dependence of current activation toward hyperpolarized potentials in a cumulative manner, whereas phosphorylation at S671 decreases the peak INa density.
Distributions and mean ± SEM. (A and B) TTX-sensitive INaL densitiesof quadruple S664-671 (A) and simple S671 (B) NaV1.5 phosphomutants. TTX-sensitive INaL were evoked during prolonged depolarizations (350 ms at −20 mV; HP = −120 mV) 48 h after transfection of HEK-293 cells with WT (black), phosphosilent (blue), and phosphomimetic (red) NaV1.5 channels and NaVβ1. No significant differences between mutant and WT channels were observed.
Distributions and mean ± SEM. (A and B) TTX-sensitive INaL densitiesof quadruple S664-671 (A) and simple S671 (B) NaV1.5 phosphomutants. TTX-sensitive INaL were evoked during prolonged depolarizations (350 ms at −20 mV; HP = −120 mV) 48 h after transfection of HEK-293 cells with WT (black), phosphosilent (blue), and phosphomimetic (red) NaV1.5 channels and NaVβ1. No significant differences between mutant and WT channels were observed.
The S671 phosphorylation site regulates the cell surface expression of NaV1.5 channels
Additional cell surface biotinylation experiments in transiently transfected HEK-293 cells were designed to determine whether the S671 phosphorylation site regulates the cell surface expression of the NaV1.5 channel protein. Interestingly, these experiments revealed that the cell surface expression of the NaV1.5-S671E phosphomimetic channel is significantly (P < 0.001) decreased compared with the WT or the NaV1.5-S671A phosphosilent channels, whereas no differences in total NaV1.5 protein expression were observed (Fig. 5, A and B). Importantly, the decrease observed with the phosphomimetic mutant, compared with the phosphosilent mutant, suggests that not only this channel locus, but also most probably phosphorylation at this particular site, underlie the observed decrease in cell surface expression. Together with the electrophysiological findings, therefore, these biochemical analyses demonstrate a key role for S671 in regulating the cell surface expression of NaV1.5, and suggest that phosphorylation at this site decreases the cell surface expression of NaV1.5-encoded channels.
The S671 phosphorylation site regulates the cell surface expression of NaV1.5. (A) Representative Western blots of total (left panel) and cell surface (right panel) NaV1.5 from HEK-293 cells transiently transfected with NaV1.5-WT + NaVβ1, NaV1.5-S671A + NaVβ1, or NaV1.5-S671E + NaVβ1. Samples were probed in parallel with the anti–transferrin receptor (TransR) and anti-GAPDH antibodies. (B) Mean ± SEM total and cell surface NaV1.5 protein expression in transiently transfected HEK-293 cells (n = 12 in six different experiments). Expression of NaV1.5 in each sample was first normalized to the TransR protein in the same blot and then expressed relative to NaV1.5 protein expression (total or cell surface) in cells transfected with NaV1.5-WT + Navβ1. Relative (mean ± SEM) NaV1.5 cell surface expression is different (***, P < 0.001, one-way ANOVA followed by the Dunnett’s post-hoc test) in cells expressing NaV1.5-WT, NaV1.5-S671A, and NaV1.5-S671E channels.
The S671 phosphorylation site regulates the cell surface expression of NaV1.5. (A) Representative Western blots of total (left panel) and cell surface (right panel) NaV1.5 from HEK-293 cells transiently transfected with NaV1.5-WT + NaVβ1, NaV1.5-S671A + NaVβ1, or NaV1.5-S671E + NaVβ1. Samples were probed in parallel with the anti–transferrin receptor (TransR) and anti-GAPDH antibodies. (B) Mean ± SEM total and cell surface NaV1.5 protein expression in transiently transfected HEK-293 cells (n = 12 in six different experiments). Expression of NaV1.5 in each sample was first normalized to the TransR protein in the same blot and then expressed relative to NaV1.5 protein expression (total or cell surface) in cells transfected with NaV1.5-WT + Navβ1. Relative (mean ± SEM) NaV1.5 cell surface expression is different (***, P < 0.001, one-way ANOVA followed by the Dunnett’s post-hoc test) in cells expressing NaV1.5-WT, NaV1.5-S671A, and NaV1.5-S671E channels.
Simulated consequences of phosphorylation on the first intracellular linker loop of NaV1.5
Like many heavily phosphorylated protein segments (Iakoucheva et al., 2004; Wright and Dyson, 2015), the first two intracellular linker loops of NaV1.5 are predicted to be intrinsically disordered. Conformational heterogeneity is one of the defining hallmarks of intrinsically disordered regions (IDRs). Heterogeneity is manifest in the amplitude of fluctuations of overall size, shape, and local secondary structural preferences. There is growing recognition of sequence specificity whereby the ensembles accessible to an IDR are governed by the amino acid composition, extent of phosphorylation, and patterning of residues within the linear sequence. These sequence–ensemble relationships can be uncovered using all-atom simulations. Given the disparate time scales and length scales involved, a robust and efficient approach is to use Markov chain Metropolis Monte Carlo simulations based on the ABSINTH implicit solvent model as implemented in the CAMPARI simulation (Vitalis and Pappu, 2009b; Mao et al., 2010; Das and Pappu, 2013). Here, we used simulations to quantify sequence–ensemble relationships for the first intracellular linker loop of human NaV1.5 containing the phosphorylation clusters S457-460, S483-486, S497-499, and S664-671 identified by MS. For our simulations, we used segments between 30 and 40 residues in length, containing each cluster in an approximately central position (441-480 for S457-460, 465-501 for S483-486, 481-515 for S497-499, 651-684 for S664-671). For each cluster, we performed simulations for the WT sequence, as well as phosphomimetic mutations where serine(s)/threonine(s) are replaced with glutamate(s). The results of simulations were analyzed using the device of internal scaling plots. These plots quantify the variation of ensemble-averaged distances between residues i and j as a function of sequence separation |j-i|. Multiple pairs of residues contribute to a given sequence separation |j-i|. The internal scaling profiles can be calibrated against reference profiles that pertain to two kinds of random-coil ensembles. These are designated as EV, which pertains to profiles extracted for self-avoiding walks, and FRC, which pertains to profiles extracted for FRCs. Details of these reference ensembles have been published elsewhere.
Simulations of the 441-480 segment showed that the conformational preferences of the unphosphorylated (WT) peptide are akin to those of the FRC reference (Fig. 6 A). This implies that sequence encodes a conformational averaging whereby the peptide–solvent and peptide–peptide interactions are mutually compensatory, thereby giving rise to an ensemble that is maximally heterogeneous. Introduction of phosphomimetic substitutions S457E, S459E, and/or S460E did not have a large effect on the ensemble-averaged internal scaling profiles when compared with the unmodified sequence. We obtained similar results for the 465-501 segment, which is also largely unaffected by the introduction of the phosphomimetic mutation(s) of the S483-486 cluster (Fig. 6 B). Conversely, the 481-515 and 651-684 segments were noticeably sensitive to the addition of the negative charges (Fig. 6, C and D). When unphosphorylated, these segments preferred conformations that are considerably more compact than the FRC reference. Upon the introduction of cumulative phosphomimetic mutations, these segments gradually expanded in the direction of the EV limit.
Simulations of phosphorylation of segments of the first intracellular linker loop of NaV1.5. The sequential distance between a pair of residues is on the x axis, and the average spatial distance between a pair of residues separated by the specified sequential distance is on the y axis. <Rij> is the average simulated spatial distance between all residue pairs separated in the amino acid sequence by |j-i| residues. The WT sequences are plotted in black. Phosphorylation is simulated by single or multiple replacement of serines/threonines with glutamates (E), and resulting simulations are plotted in gradations of red. The FRC (in blue) and EV (in purple) limits are plotted for reference (see text). (A) Sequence 441-480 contains the phosphosites S457, S459, and S460. (B) Sequence 465-501 contains the phosphosites S483, S484, and T486. (C) Sequence 481-515 contains the phosphosites S497 and S499. (D) Sequence 651-684 contains the phosphosites S664, S667, T670, and S671.
Simulations of phosphorylation of segments of the first intracellular linker loop of NaV1.5. The sequential distance between a pair of residues is on the x axis, and the average spatial distance between a pair of residues separated by the specified sequential distance is on the y axis. <Rij> is the average simulated spatial distance between all residue pairs separated in the amino acid sequence by |j-i| residues. The WT sequences are plotted in black. Phosphorylation is simulated by single or multiple replacement of serines/threonines with glutamates (E), and resulting simulations are plotted in gradations of red. The FRC (in blue) and EV (in purple) limits are plotted for reference (see text). (A) Sequence 441-480 contains the phosphosites S457, S459, and S460. (B) Sequence 465-501 contains the phosphosites S483, S484, and T486. (C) Sequence 481-515 contains the phosphosites S497 and S499. (D) Sequence 651-684 contains the phosphosites S664, S667, T670, and S671.
Taken together, the results suggest that the intrinsic conformational preferences of the WT sequence dictate the extent of responsiveness of the conformational ensemble to multisite phosphorylation. Sequence stretches that have an intrinsic preference for FRC-like conformations are relatively insensitive to phosphomimetic substitutions of serine/threonine residues. This insensitivity has been quantified for IDRs that undergo multisite phosphorylation (Martin et al., 2016). In contrast, sequences that have an intrinsic preference for compact conformations become responsive to phosphomimetic substitutions. This would appear to derive from the increased fraction of charged residues (FCR; which engenders preferential solvation) and electrostatic repulsions (Mao et al., 2010). The FCR and the net charge per residue are known to be direct determinants of the conformational preferences of IDRs (Holehouse and Pappu, 2018). Both the 441-480 and 465-501 segments have a higher FCR than the 481-515 and 651-684 segments. The addition of a single negative charge would lead to a greater percentage increase in the FCR of the 481-515 and 651-684 segments than it would for the 441-480 and 464-501 segments. As the latter are already expanded, additional charges do not have a large impact on the conformational preference. The more compact starting point of the former allows the phosphomimetic mutations to have a greater effect. While the results for three of the clusters were consistent with the experimental data, those for the S497-499 cluster present an apparent inconsistency. These observations suggest that the ability of this segment to expand due to the addition of charge is not connected to channel gating. Together with the electrophysiological analyses, therefore, these simulations suggest that the effect of phosphorylation at S664 and S667 on the voltage dependence of channel activation is mediated by the expansion of the area containing the phosphorylation sites and that this expansion is likely to regulate channel activation allosterically.
Discussion
The results presented here provide a novel, detailed phosphorylation map of the native mouse left ventricular NaV1.5 channel protein, and identify the functional roles of three of these phosphorylation sites in regulating the expression and gating properties of NaV1.5-encoded channels. The highly phosphorylated S664 and S667 regulate the voltage dependence of channel activation in an additive manner, whereas S671, in which phosphorylation is increased in TAC mouse left ventricles, regulates NaV1.5 cell surface expression and peak INa density. No additional roles could be assigned to the other clusters of NaV1.5 phosphorylation sites, suggesting additional complexity in the mechanisms mediating the phosphorylation-dependent regulation of cardiac NaV1.5 channels.
Phosphorylation map of native mouse left ventricular NaV1.5 channels
The present phosphoproteomic analysis confidently identified a total of 42 native phosphorylation sites in the NaV1.5 channel protein purified from mouse left ventricles, of which 19 are novel (Table S2). 17 of these sites were also found to be phosphorylated in heterologously expressed human NaV1.5 channels (Herren et al., 2015), suggesting that about half of this phosphorylation pattern is conserved among species (mouse and human) and cellular systems (native channels in left ventricles and recombinant channels in HEK-293 cells), whereas the others may be associated with more specific and/or localized regulation. Among the sites identified, only six were previously suggested to be the targets for specific kinases using in silico and/or in vitro analyses: S36 and S525 were attributed to the regulation by PKA; S484 and S664 were assigned to the serum- and glucocorticoid-inducible kinase 3 (SGK3); and S516 and S571 were ascribed to CaMKII (reviewed in Marionneau and Abriel, 2015). In marked contrast, several previously described phosphorylation sites were not detected in the present study, including the PKA-dependent S528, the CaMKII-associated T594, the PKC-dependent S1506, the adenosine monophosphate–activated protein kinase (AMPK)–dependent T101 (Liu et al., 2019), and the six Fyn-dependent tyrosines (Ahern et al., 2005; Iqbal et al., 2018). Although these latter sites have never been identified in native cardiac tissues and may simply not exist in the myocardium, it is also possible that the MS detection of these sites here was prevented because of technical limitations. Indeed, a few cytoplasmic regions of the channel were not covered in our analysis, most probably because of the presence of too many, or on the contrary not enough, surrounding tryptic cleavage sites (see regions not highlighted in Fig. 2). These areas comprise a total of 24 serine/threonine/tyrosine residues, including T101 and S1506, which may, therefore, have been missed. Additionally, the low levels of threonine and tyrosine phosphorylation, compared with phosphoserines, may have limited the identification of phosphothreonines and phosphotyrosines (Johnson and White, 2012). Overall, of the 188 cytoplasmic serine/threonine/tyrosine residues in NaV1.5, 42 (22%) are phosphorylated, and 24 (13%) are not identified in the MS data acquired.
Strikingly, and consistent with previous studies from our laboratory (Marionneau et al., 2012b; Burel et al., 2017) and the Bers group (Herren et al., 2015), the results obtained and presented here again revealed that the first intracellular linker loop of NaV1.5 is a hot spot for phosphorylation, with a total of 21 sites identified. Comparisons of the relative abundances of the phosphopeptides identified three highly abundant (and highly phosphorylated) clusters of phosphorylation sites in the first intracellular linker loop of NaV1.5 in mouse left ventricles. Retrospectively, it is interesting to note that these most abundant phosphorylation sites were already detected in previous less sensitive MS analyses from our laboratory (Marionneau et al., 2012b; Burel et al., 2017; see Table S2). The simplest interpretation of these findings is that these three phosphorylation clusters, at positions S457-S460, S483-T486, and S664-S671, are likely involved in regulating the basal and/or gating properties of native cardiac NaV1.5 channels. Conversely, the other phosphorylation sites, with lower stoichiometries, may play spatially or temporally distinct roles in the physiological or more pathophysiological regulation of channel expression or gating. This suggestion is highlighted for residue S671, for example, which is substantially (10-fold) less phosphorylated than the nearby S664 and S667 residues in WT mouse left ventricles, but is (twofold) up-regulated in TAC left ventricles. Remarkably, this MS analysis also revealed that the vast majority of identified phosphorylation sites (at least 26) are clustered, suggesting concomitant phosphorylation and roles in regulating channel expression and/or function. Unexpectedly, however, except for S664, S667, and S671, no apparent effects of phosphomimetic or phosphosilent mutations were observed on heterologously expressed (in HEK-293 cells) NaV1.5 current densities or biophysical properties, suggesting a greater complexity than anticipated in the mechanisms contributing to phosphorylation-dependent regulation of NaV1.5 channels.
The S664 and S667 phosphorylation sites regulate the voltage dependence of NaV1.5 channel activation
The electrophysiological analyses presented here identified key roles of S664 and S667 in regulating the voltage dependence of NaV1.5 channel activation. Indeed, the data demonstrate that the voltage dependence of activation of the quadruple phosphosilent channels at positions S664-671 is shifted toward depolarized potentials, compared with the WT and the quadruple aspartate phosphomimetic channels, whereas the quadruple glutamate phosphomimetic channels display a smaller shift. These findings are consistent with WT channels being phosphorylated at S664 and S667 in HEK-293 cells, as previously reported (Herren et al., 2015), and suggest that disruption of phosphorylation at these sites impacts channel gating.
Further analyses of the roles of each of the four phosphorylation sites in this cluster revealed the specific involvement of S664 and S667 in regulating gating, whereas modifying T670 or S671 was without effects. Interestingly, however, the single glutamate mutations at S664 and S667 produced the same effects as the single phosphosilent mutations. These observations suggest that the consequences of glutamate substitution, which introduces a single negative charge with a small hydrated shell, and the addition of a phosphate group, which introduces two negative charges with a large hydrated shell (Hunter, 2012), are functionally quite distinct. It also seems likely that one glutamate at these loci (in single S664 and S667 phosphomimetic channels) is not sufficient to mimic phosphorylation and that multiple glutamates (i.e., in the quadruple phosphomimetic channel) only partially mimic phosphorylation. The fact that the shifts induced by the single phosphosilent mutations are half the shift generated by the quadruple phosphosilent mutation further supports this hypothesis and suggests that regulation involving these two sites is cumulative and most likely concomitant. Nevertheless, further investigations, aimed at demonstrating the role of phosphorylation, rather than any other structural determinants associated with this locus, are certainly warranted. In this regard, our findings are also in accordance with previous data reporting the role of SGK3 in shifting the voltage dependence of channel activation toward more hyperpolarized potentials in Xenopus laevis oocytes, whereas the opposite effect was observed with the NaV1.5-S664A phosphosilent channel (Boehmer et al., 2003). Although the involvement of SGK3 and S664 in a shared regulation was not directly shown in this previous study, it is tempting to speculate that SGK3 may constitute the kinase phosphorylating S664 and S667 and mediating this regulation.
The effects of phosphorylation were also analyzed using an all-atom simulations approach to determine how the introduction of negative charges affects the conformational ensemble of the segments containing the phosphorylation clusters identified by MS. These simulations demonstrate that the introduction of negative charges at positions S497-S499 and S664-671 could expand the structure of the containing segments, whereas no effects are likely with the segments containing the S457-460 and S483-486 phosphorylation clusters. Furthermore, for both of the affected segments, the expansion likely gradually increases with the cumulative addition of charges. Interestingly, the simulation findings are consistent with the additive roles of S664 and S667 in regulating the voltage dependence of channel activation observed in the electrophysiological analyses. Consistent with the proximity of the S664-671 phosphorylation cluster to the DII voltage-sensing domain of NaV1.5, which is tightly linked to channel activation (Varga et al., 2015), our findings suggest that phosphorylation at S664 and S667 regulates channel activation through the expansion of the C-terminal extremity of the first intracellular linker loop of the channel. However, no effects on channel gating were observed with the S497-499 phosphomimetic mutant, even though the simulation showed an effect on its ability to expand. This result suggests that the expansion of this segment, which is more distal to the DII voltage-sensing domain, does not regulate channel gating.
The S671 phosphorylation site regulates NaV1.5 channel cell surface expression and peak INa density
The functional analyses also demonstrate that mimicking phosphorylation at S671 decreases the expression of the NaV1.5 protein at the cell surface, as well as peak INa density in HEK-293 cells. These results suggest that S671 is not phosphorylated in HEK-293 cells, which is in agreement with the previously published MS analyses (Herren et al., 2015). While the phosphomimetic mutation greatly decreases the cell surface expression of NaV1.5, the phosphosilent mutation also reduces NaV1.5 surface expression, albeit to a much smaller extent. These confounding results suggest that the regulation mediated by this locus highly depends on structural changes and that the phosphomimetic mutation affects the cell surface expression of the channel in part through a change in the structure of the locus. One could further suggest that the greater effect of the phosphomimetic channel may be caused by additional attributes common to the phosphate group and the glutamate side chain. Together, therefore, these findings highlight the novel role of this locus, and potentially of phosphorylation at this site, in regulating the cell surface expression of NaV1.5 channels.
Interestingly, the MS analyses also revealed that phosphorylation at S671 is increased in the left ventricles of TAC mice, suggesting a role in mediating the NaV channel defects associated with heart failure. Because previous studies have suggested that CaMKII-dependent phosphorylation of NaV1.5 may constitute one of the molecular mechanisms mediating the increased INaL in heart failure (Wagner et al., 2006; Maltsev et al., 2008; Koval et al., 2012; Aiba et al., 2013; Toischer et al., 2013; Glynn et al., 2015), this finding prompted us to examine the INaL generated by the phosphosilent and phosphomimetic NaV1.5 mutants at position 671. Our results herein appeared negative, although it cannot be excluded that this regulation may require a specific molecular and cellular environment that is not recapitulated in HEK-293 cells. Additionally, and to our surprise, no changes in phosphorylation at S571 were observed in our TAC model, in contrast with previous findings in nonischemic human heart failure (Koval et al., 2012) and in several animal models of heart disease (Koval et al., 2012; Toischer et al., 2013; Glynn et al., 2015). These seemingly disparate findings may reflect technical and/or experimental differences, including differences in the models used and/or stages of disease.
The results presented here raise the interesting and novel possibility that increased phosphorylation at S671 participates in decreasing the peak INa often observed in heart failure. Consistent with this suggestion, a recent study by the Remme group, using superresolution microscopy, showed a reduction in the size of NaV1.5 clusters in TAC ventricular myocytes without any changes in NaV1.5 transcript or total protein expression (Rivaud et al., 2017). Although further studies will be required to determine directly whether these observations are causally linked to increased phosphorylation at S671, the results here provide new hints at understanding the molecular basis of the decreased peak INa in heart failure.
Altogether, the results presented here demonstrate that native mouse ventricular NaV1.5 is highly phosphorylated and that the mechanisms mediating the phosphorylation-dependent regulation of NaV1.5-encoded channels are site-specific, complex, and dynamic and lead to diverse physiological and/or pathological consequences on both channel gating and expression.
Acknowledgments
Olaf S. Andersen served as editor.
The expert technical assistance of Petra Erdmann-Gilmore, Yiling Mi, and Rose Connors is gratefully acknowledged.
This work was supported by the Agence Nationale de la Recherche (ANR-15-CE14-0006-01 and ANR-16-CE92-0013-01 to C. Marionneau), the Deutsche Forschungsgemeinschaft (Ma 1982/5-1 to L.S. Maier), and the National Institutes of Health (R01-HL148803 to C. Marionneau, R.V. Pappu, and J.R. Silva; R01-HL034161 and R01-HL142520 to J.M. Nerbonne; and 5R01NS056114 to R.V. Pappu). The MS experiments were performed at the Washington University Proteomics Shared Resource (WU-PSR), which is supported in part by the WU Institute of Clinical and Translational Sciences (National Center for Advancing Translational Sciences grant UL1 TR000448), the Mass Spectrometry Research Resource (National Institute of General Medical Sciences grant P41 GM103422), and the Siteman Comprehensive Cancer Center Support Grant (National Cancer Institute grant P30 CA091842). M. Lorenzini was supported by a Groupe de Réflexion sur la Recherche Cardiovasculaire–Société Française de Cardiologie predoctoral fellowship (SFC/GRRC2018). S. Burel was supported by a Fondation Lefoulon Delalande postdoctoral fellowship. The content of the research reported is solely the responsibility of the authors and does not necessarily represent the official views of the funding agencies.
The authors declare no competing financial interests.
Author contributions: C. Marionneau designed the study and wrote the paper. C. Marionneau, D. Maloney, J.M. Nerbonne, R.R. Townsend, and L.S. Maier designed, performed, and/or analyzed the MS experiments. M. Lorenzini, S. Burel, A. Lesage, C. Charrière, P.-M. Chevillard, B. Evrard, J.M. Nerbonne, and C. Marionneau designed, performed, and/or analyzed the functional analyses. E. Wagner, K.M. Ruff, R.V. Pappu, and J.R. Silva designed, performed, and/or analyzed the modeling analyses. S. Wagner and L.S. Maier provided the sham/TAC mice and performed mouse echocardiography. All authors reviewed the results and approved the final version of the manuscript.
